KEGG   Loxodonta africana (African savanna elephant): 100664965
Entry
100664965         CDS       T04351                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04611  Platelet activation
lav04730  Long-term depression
lav04810  Regulation of actin cytoskeleton
lav04928  Parathyroid hormone synthesis, secretion and action
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100664965 (GNA13)
   04072 Phospholipase D signaling pathway
    100664965 (GNA13)
   04071 Sphingolipid signaling pathway
    100664965 (GNA13)
   04022 cGMP-PKG signaling pathway
    100664965 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100664965 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100664965 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100664965 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100664965 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    100664965 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664965 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100664965 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100664965 (GNA13)
   04031 GTP-binding proteins [BR:lav04031]
    100664965 (GNA13)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100664965 (GNA13)
  Exosomal proteins of colorectal cancer cells
   100664965 (GNA13)
GTP-binding proteins [BR:lav04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    100664965 (GNA13)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 100664965
NCBI-ProteinID: XP_003417342
LinkDB
Position
Unknown
AA seq 282 aa
MRVLVDAREKLHIPWGDNTNQFNGEKMMAFDTRSPMAAQGMVETRVFLQYLPAIRALWAD
SGIQHAYDRRREFQLGESVKYFLDNLDKLGEQDYIPSQQDILLARRPTKGIHEYDFEIKN
VPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETI
VNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRR
DQQQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ
NT seq 849 nt   +upstreamnt  +downstreamnt
atgagggtgctggtagatgctcgagagaagcttcacattccttggggagataatacaaac
caattcaatggagagaagatgatggcatttgacacacggtcacccatggcggcccaggga
atggtggaaaccagggtgttcctacagtatcttcctgctataagagccttatgggcagat
agtggcatacagcatgcctatgaccggcgtcgagaatttcaactgggtgaatctgtaaaa
tatttcttggataatttggataaactcggagaacaagattacattccatcacaacaagat
attctgcttgccagaagacccaccaaaggcattcatgagtacgactttgaaattaaaaac
gttcctttcaaaatggttgatgtagggggtcaaagatcagaaaggaaacgttggtttgag
tgctttgacagtgtgacatcaatactgttccttgtttcctcaagtgaatttgaccaggtg
cttatggaagaccgactgaccaatcgccttacagaatctctgaacatttttgaaaccatc
gtcaacaaccgggttttcagcaacgtctccataatactcttcttaaacaagacagacttg
ctcgaggagaaagtgcagattgtcagcatcaaagactatttcttagaatttgaaggggat
ccccactgcttaagagacgtccaaaaattcctggtggaatgtttccgtaacaaacgccgg
gaccagcagcagaagcccttataccaccacttcaccactgctatcaacacagaaaacatc
cgcctcgttttccgtgatgtgaaggatactattcttcacgacaacctcaagcagcttatg
ctacagtga

DBGET integrated database retrieval system