KEGG   Loxodonta africana (African savanna elephant): 100665050
Entry
100665050         CDS       T04351                                 

Definition
(RefSeq) cholesterol side-chain cleavage enzyme, mitochondrial
  KO
K00498  cholesterol monooxygenase (side-chain-cleaving) [EC:1.14.15.6]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00140  Steroid hormone biosynthesis
lav01100  Metabolic pathways
lav04913  Ovarian steroidogenesis
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
Module
lav_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100665050
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100665050
   04925 Aldosterone synthesis and secretion
    100665050
   04927 Cortisol synthesis and secretion
    100665050
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100665050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lav00199]
    100665050
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.6  cholesterol monooxygenase (side-chain-cleaving)
     100665050
Cytochrome P450 [BR:lav00199]
 Cytochrome P450, animal type
  CYP11 family
   100665050
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100665050
NCBI-ProteinID: XP_003413982
LinkDB
Position
Unknown
AA seq 521 aa
MLARGLPPRSVRLRGFRSLLSALWEGPGHPRVPTGEGANSICTQSPRPYSEVPSPGDNGW
LNLYHFWREKGLHQLHYRQVQNFQKFGPIYREKLGTMDSVFIVSPEDAAILYKSEGPLPE
RYHVPPWTAYHQHYKKPIGVLFKKSEDWKKDRLALNQELMALESIKNFVPLLDPVSQDFV
SLLHRRINQQGFGKYSGDISDDLFRFAFESVTNVVFGERLGILQETVDPEAQQFIDAVYQ
MFHTSVPMLSIPPDLFRLLRTKTWRDHVAAWEVIFSKAEQYTQRFYGDLRQKKVFDNYPG
ILYRLLDSSKLPFDNIKANAIELLAGGVDTTSMTLQWNMYEMARSLRVQEVLRAEVLAAR
RQAKGDMNMMLKLVPLLKASIKETLRLHPISVTVQRYLPNDVVIRNYKIPAKTLVQVAVF
AMGRDPAFFSNPECFDPARWLNKDKDITYFRNLGFGWGSRQCVGRRIAEVEMTIFLIHIL
ENFKIEIQNLSDVNTKFNLILMPDKPIFLTFRPFNMDLLHM
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgctggctagaggactccccccacgctcagtccggctcagaggcttccggtccctcctg
agtgccctgtgggagggcccggggcatcccagggtgccgactggagaaggagccaatagc
atctgcacacaaagccctcgcccctacagtgaagtcccttcccctggtgacaatggctgg
ctgaacctgtaccacttctggagggagaagggtttgcaccaactccactaccgccaggtc
cagaatttccagaagtttggccccatttacagggagaagctaggcaccatggactcggtt
tttattgtcagccctgaagatgcggccattctctataagtctgagggccccctcccagaa
cgctaccacgtcccaccctggactgcttatcaccagcattacaagaaacccatcggggtc
ctgttcaagaagtcagaagactggaagaaagaccggttagccctgaaccaggagctgatg
gctctggagagcataaaaaacttcgtgcccctgctggacccagtgtctcaggacttcgtc
agcctcttgcacaggcgcatcaatcagcaaggctttgggaagtactcaggggacatcagt
gatgacctgttccgctttgcctttgagtctgtcaccaacgttgtatttggggagcggctg
gggatactgcaggagacggtggatcctgaggcccagcagttcattgatgcggtataccag
atgttccacactagcgtccccatgctcagcatccccccagatctgttccgcctgctcagg
accaagacctggagggaccacgtggctgcatgggaggtgattttcagtaaagctgaacaa
tatacccagaggttctatggggacctgagacaaaaaaaagtttttgacaattaccctggc
atcctctaccgcctcctggacagtagcaagctgccctttgacaacatcaaggccaatgct
attgaactgctggctggtggcgtggacacgacatccatgacactgcagtggaacatgtat
gagatggcccgcagcctgagggtacaggaggtgctgagggcagaggtcctggctgcccgg
cgccaggccaagggagacatgaacatgatgctcaagttggttccgctcctcaaagccagc
atcaaagagacgctgagactccaccccatctccgtgacagttcagagatatcttccaaat
gatgtggttattcgtaattacaagattcctgccaagacattggtacaggtggccgtcttc
gccatgggtcgggatcccgccttcttctccaacccagagtgttttgacccagcccgatgg
ctaaacaaagacaaggacatcacctacttccggaacctgggctttggctggggtagccgg
cagtgtgtggggcggcgcatcgccgaggttgagatgacaatcttccttatccatattctg
gaaaacttcaaaattgagatccaaaatctcagtgatgtgaataccaagttcaatctcatc
ctgatgcctgacaagcccatcttcttaaccttccggcccttcaacatggacctgctccac
atgtga

DBGET integrated database retrieval system