KEGG   Loxodonta africana (African savanna elephant): 100665091
Entry
100665091         CDS       T04351                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X2
  KO
K02084  apoptotic protease-activating factor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05134  Legionellosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100665091 (APAF1)
   04215 Apoptosis - multiple species
    100665091 (APAF1)
   04115 p53 signaling pathway
    100665091 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100665091 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100665091 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100665091 (APAF1)
   05012 Parkinson disease
    100665091 (APAF1)
   05014 Amyotrophic lateral sclerosis
    100665091 (APAF1)
   05016 Huntington disease
    100665091 (APAF1)
   05020 Prion disease
    100665091 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100665091 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100665091 (APAF1)
   05152 Tuberculosis
    100665091 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100665091 (APAF1)
   05160 Hepatitis C
    100665091 (APAF1)
   05164 Influenza A
    100665091 (APAF1)
   05162 Measles
    100665091 (APAF1)
   05168 Herpes simplex virus 1 infection
    100665091 (APAF1)
   05169 Epstein-Barr virus infection
    100665091 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100665091 (APAF1)
SSDB
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 CARD Ge1_WD40 WD40_like CARD_2 AAA_16 Nbas_N Utp8 AAA_22 ATPase_2 NACHT
Other DBs
NCBI-GeneID: 100665091
NCBI-ProteinID: XP_003405326
LinkDB
Position
Unknown
AA seq 1245 aa
MDAKARNCLLQHREALERDIKTAYIMDHMISDGVLTLLEEEKVKIEPTQQQRAAMLIKMI
LQKDNYSYISFYNALLHEGYRDLADRLRGGLPDVSSSNGKDSVGGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLNGEPGWVTIYGMAGCGKSVLAAEAIRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDGNFSQRPPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLRQLQNKQFKRIRKSSFYD
YEALDEAMSISVEMLREDTKNYYTDLSILQKDVKVPTKVLCILWDLETEEAEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKMITQFQRYHQLHPLSPDQEDC
MYWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCTV
CENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGTLYLEWINK
KNMKNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSADDRFIATCSVDKQVKIWDSVTGELVRTYDEHSEQVNCCHFTNNGHHLLLATGS
SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDTLLASCSADGSLKLWDVRSANERKS
INVKQHFPDSEDPQEDIEVIVKCCSWSADGARIMVAAKNKIFLFDIDSSGLLAEIPTGHH
STIQYCDFSPHNHLAVVTLSQYCVELWNTDSCLKVADCRGHLSWVHSVMFSPDGSSFLTS
SDDQTIRVWETKKVCKNSAVVLKQEVDVVFQENEVMVLAVDNIKRLQLINGKTGQIDYLT
EAQVSCCCLSPQLQYVAFGDEDGAIEILELLNGRIFQSRIRHKKAVRHIQFTADGKTLIS
SSDDSTIQVWNWRSEEYVFLQAHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGRIEKD
FVCHQDTVLSCDISPDATKFSSTSADKTAKIWNFDLLFPLHELSGHTGCVRCSVFSVDST
LLATGDDNGEIRIWNVSNGELLGLCSVEGAATHGGWVTDLCFSPDSKMLVSSGAYLKWWN
VVTGESSQTFYTNGTNLKKIHVSPDFKTFVTVDNLGILYILQILE
NT seq 3738 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttacttcaacacagagaagccctggaaagagacatc
aagacagcctatatcatggatcacatgattagtgatggagttttaacattattggaagag
gaaaaagtgaaaattgagcccactcaacagcagcgagcagctatgctaattaaaatgata
cttcaaaaagataattattcctacatatcattctacaatgctctactgcatgaagggtat
agagatctggctgaccgtctccgtggtggtcttcctgatgtctcttcttccaatggcaaa
gattcagttggtggaataacttcatatgtaaggacagtcctttgtgaaggtggagtacca
cagaggccagttgtttttgttactagaaagaagctggttaatgcaattcagcagaagctc
tccaaactgaacggtgaaccgggatgggtcaccatatatggaatggcaggctgcgggaag
tctgtattagctgcagaagctattcgagatcattccctcttagaaggttgtttcccaggg
ggtgtgcattgggtttcagttggaaaacaagataaatctgggcttctgatgaaactgcaa
aatctttgcacacgattggaccaagatggcaatttctcccagaggcctccacttaatatt
gaagaagctaaagaccgtctccgcatcctgatgctgcgcaaacacccgaggtcactcttg
atcttggatgatgtttgggatccttgggttttaaaagcttttgacaatcagtgtcaaatt
cttcttacaaccagagacaagagtgttacagattcagtaatgggccctaaatatgtggtt
cctgtggagagtagcttaggaaaagaaaaaggacttgaaattttatcgctttttgttaat
atgaagaaagcagatttgccagaacaagctcatagtattataaaagaatgtaaaggttct
cctcttgtagtgtctttaattggtgcacttttacgtgattttcccaatcgttgggagtac
tacctcaggcaacttcagaataagcaatttaagagaatcaggaaatcttcattttatgat
tatgaggctctggatgaagccatgtctataagtgttgaaatgctcagagaagacaccaag
aattattacacagatctttccatcctccagaaggatgttaaagtgcctacaaaggtgtta
tgtattctctgggacttggaaactgaagaggctgaagacatactgcaggagtttgttaat
aagtccctcttattctgcgatcgaaatggaaaatcatttcgttattatttacatgatctt
caagtagatttccttacagagaagaattgcagccaacttcaggatctgcataagaagatg
attactcagttccaaaggtatcaccagctacatcctctttcaccagatcaggaggattgc
atgtactggtacaactttctggcctatcacatggccagtgccaatatgcacaaagaactt
tgtgctttaatgttttccctggattggattaaagcaaaaactgaacttgtaggccctgct
catctgattcatgaatttgtggaatataggcatatattggatgagaaggattgcacagtc
tgtgagaattttcaggaatttttatctttaaatggacaccttcttggacgacagccattt
cctaatattgtacaactgggtctctgtgaaccggaaacttcagaagtttatcagcaagct
aagcttcaggccaagcaggaggtcgataacggaacgctttacctggagtggataaacaaa
aaaaacatgaagaatctctcccgcttagttgtccgcccccatacggatgctgtttaccat
gcctgcttttctgaggatggtcagagaatagcatcttgtggagctgataaaaccttacag
gtgttcaaagctgagacaggagagaagcttctagaaatcaaggctcatgaagatgaagtg
ctttgctgtgcattctctgcagatgacaggtttatagcaacctgctcagtggataaacaa
gtgaaaatttgggattctgtgactggggaactagtacgtacctatgatgagcactcagag
caagtcaattgctgccatttcaccaacaacggtcatcaccttctcctcgccactggctca
agtgattgcttcctcaaactctgggatttgaatcaaaaagaatgtcgaaataccatgttt
ggccatacaaattcagtcaatcactgtagattttcaccagatgatacgcttttggccagt
tgttcagctgatggatcattaaagctttgggatgtgagatcagcaaatgagaggaaaagc
attaacgtgaaacagcacttcccagattcagaggatcctcaagaggatatagaagtgata
gtgaaatgttgttcctggtctgctgatggtgccaggataatggtggcagcaaaaaataaa
atctttctttttgacattgattccagtggcctattggcagaaatccccacaggacatcat
agtaccatccagtactgtgacttctctcctcataaccatttggcagtggtgactttgtcc
cagtactgtgtggagttgtggaatacagactcgtgtttaaaagtagctgactgcagagga
catttaagttgggttcattctgtgatgttttctcctgatggttcatcatttttgacatct
tctgatgaccagacaatcagggtctgggagacaaagaaagtatgtaagaactctgcagta
gtgttaaagcaagaagtagatgttgtgtttcaagagaatgaagtgatggttcttgcagtt
gacaatataaaacgtctacaactcattaatggaaaaacaggtcagattgattacctgact
gaagctcaagttagctgctgttgcttaagtccacaacttcagtacgttgcatttggagat
gaagatggggccattgagattttagaactcctaaatggcagaatcttccagtccaggatt
agacacaagaaagctgtacggcacattcagttcacagctgatgggaagactcttatttca
agctccgatgattctacaattcaggtatggaattggcggtcagaggaatatgtctttctg
caagcccatcaggaaacagtgaaagacttcaggctcttgaaaaattcaagactgctttct
tggtcatttgatggaacagtgaaggtgtggaatattattactggaagaatagaaaaagac
tttgtctgtcaccaggatacagtactctcttgtgatatttctcctgatgctaccaagttt
tcatctacctctgctgacaagactgcaaagatctggaattttgacctccttttccctctt
catgaattgagtggccacacaggctgtgtgcgctgctccgtcttctctgtggacagtacc
ctgctggcgactggagatgacaacggagaaatcaggatatggaatgtctcaaacggtgag
cttcttggtttgtgttcggtagaaggagctgctacccacggaggctgggtgaccgacctt
tgcttttctccagatagcaaaatgcttgtctcctctggggcatatcttaagtggtggaat
gttgtcactggggaatcttcacagaccttctacacaaatggaaccaatctgaagaaaata
cacgtgtcccctgacttcaaaacgtttgtgactgttgataatcttggtattttatatatt
ttacagattttagagtaa

DBGET integrated database retrieval system