KEGG   Loxodonta africana (African savanna elephant): 100665139
Entry
100665139         CDS       T04351                                 

Gene name
MAP3K2
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 2
  KO
K04420  mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04540  Gap junction
lav04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100665139 (MAP3K2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100665139 (MAP3K2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100665139 (MAP3K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100665139 (MAP3K2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100665139 (MAP3K2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE11 family
   100665139 (MAP3K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 100665139
NCBI-ProteinID: XP_003416734
LinkDB
Position
Unknown
AA seq 620 aa
MMDDQQALNSIMQDLAVLHKASRPALSLQETRKTKSLSPKKQNDVRVKFEHRGEKRILQF
SRPVKLEDLRSKAKVAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILL
VVNGSTQATNLEPLPSLEDLDNTVFGAERKKRLSVIGSTSRDRSSPPPGYIPDELHQVAR
NGSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGENYPKSRMPRAQS
YPDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHQQEYNDGRKTFPRARRNQGTSFRSPV
SFSPTDHSLSTSSGSSIFTPECDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLG
KLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIV
QYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMI
VHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYG
RKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFV
EAKLRPSADELLRHMFVHYH
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgatggatgatcaacaagctttgaactcaatcatgcaagatttggctgtccttcataag
gccagtcgaccagcattatccttacaggaaaccagaaaaacaaagtctttgtcaccaaaa
aaacagaatgatgttcgagtcaaatttgaacatagaggagaaaaaagaattcttcagttc
tccaggccagttaaactggaagatctgaggtctaaagctaaagtcgcctttggacagtct
atggatctacattataccaacaatgagttggtaattccactgactactcaagatgacctg
gacaaagctgtggaattgctagatcgtagcattcacatgaagagcctcaagatactactt
gtagtaaatggaagtacacaggctactaatttagaaccattaccatcactagaagacttg
gataacacagtatttggagcagaaaggaaaaaacggctttctgtgataggttctactagt
agagatagaagctcccctcccccgggatacattccagatgaattacatcaggttgctcgg
aatgggtcattcactagtatcaacagtgaaggagagttcattccagaaagcatggaccaa
atgctggatccattatctttaagcagccctgaaaattctggctcaggaagctgtccatca
cttgatagtcctttggatggagagaactatccaaaatcacgaatgcccagggcacagagc
tacccagataaccatcaagaattttcagactatgataaccctatctttgagaaatttgga
aaaggaggaacatatccaagaaggtatcatgtttcctatcaccagcaagagtataacgat
ggtcgtaaaacttttcccagagctagaaggaaccaggggaccagcttccggtctcctgtg
agttttagtcccactgaccattccttaagcactagtagtggaagcagtatcttcacccca
gagtgtgacgacagtcggataagaagaaggggaagtgacatagacaaccctactctgact
gtaatggacatcagcccacccagccggtcacctcgtgctccaaccaactggagattgggc
aaactgctgggccagggagcctttggcagggtctacctctgttacgacgtcgatacagga
agagaattggctgttaaacaagttcaatttgaccctgatagccctgagaccagcaaggaa
gtgaatgcacttgagtgtgaaattcagttgttgaaaaacttgctgcatgaacgaattgtt
cagtattatggctgtctgagggatccccaggaaaaaacactttccatatttatggaatat
atgccagggggttcaattaaggaccaactaaaagcatacggggctcttactgagaacgtg
accaggaagtacacccgccagattctggagggtgtccattatttgcacagtaacatgatt
gtccatagagatatcaaaggtgcaaatattttgcgagactcaacaggcaatgtcaaacta
ggagattttggggccagcaaacggcttcagaccatctgtctctcagggacaggaatgaag
tcagtcacaggcacaccatactggatgagccctgaagtgatcagtggagaaggctatggc
agaaaagcagatatctggagtgtagcctgcactgtggtggaaatgctaacggaaaagccc
ccttgggctgagtttgaagcaatggctgccatctttaaaatcgctacccagccgacaaac
ccaaagctgccaccccacgtctcagactatactcgggatttcctcaaacggatttttgtg
gaggccaaactgagaccctcagctgacgagctcttgaggcacatgtttgtgcattatcac
tag

DBGET integrated database retrieval system