KEGG   Loxodonta africana (African savanna elephant): 100665332
Entry
100665332         CDS       T04351                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04915  Estrogen signaling pathway
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05223  Non-small cell lung cancer
lav05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100665332 (TGFA)
   04012 ErbB signaling pathway
    100665332 (TGFA)
   04014 Ras signaling pathway
    100665332 (TGFA)
   04151 PI3K-Akt signaling pathway
    100665332 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100665332 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100665332 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100665332 (TGFA)
   05212 Pancreatic cancer
    100665332 (TGFA)
   05225 Hepatocellular carcinoma
    100665332 (TGFA)
   05214 Glioma
    100665332 (TGFA)
   05211 Renal cell carcinoma
    100665332 (TGFA)
   05215 Prostate cancer
    100665332 (TGFA)
   05223 Non-small cell lung cancer
    100665332 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100665332 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 Cortexin FAM176
Other DBs
NCBI-GeneID: 100665332
NCBI-ProteinID: XP_023408517
LinkDB
Position
Unknown
AA seq 140 aa
MDLSPMSFLSPAEPPVAAAVVSHFNDCPDSHSQFCFHGTCRFLVQEDKPACVCHSGYVGA
RCEHADLLAVVAASQKKQAITALVVVSIVALGILIITCVLIHCCEVRKHCEWCRALICRH
EKPSALLKGRTACCHSETVV
NT seq 423 nt   +upstreamnt  +downstreamnt
atggatctgagcccaatgtcttttctctccccagcagaaccgcctgtagccgccgctgtg
gtatcccattttaatgactgcccagactcccacagccagttctgcttccatggaacctgc
aggtttttggtacaggaggacaagccagcttgtgtctgccactctgggtatgtcggtgca
cgctgtgagcatgcagacctcctggccgtggtggccgccagccagaagaagcaggccatc
accgccttggtcgtagtctccatcgtggccctgggtatcctcatcatcacgtgtgtgctg
atacactgctgtgaggtccgaaagcactgtgagtggtgccgtgccctcatctgccggcac
gagaagcccagtgccctcctgaaggggaggactgcctgctgccactcagaaacagtggtc
taa

DBGET integrated database retrieval system