KEGG   Loxodonta africana (African savanna elephant): 100665433Help
Entry
100665433         CDS       T04351                                 

Gene name
ALPI
Definition
(RefSeq) intestinal-type alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00730  Thiamine metabolism
lav00790  Folate biosynthesis
lav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100665433 (ALPI)
   00790 Folate biosynthesis
    100665433 (ALPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100665433 (ALPI)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100665433 (ALPI)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100665433 (ALPI)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100665433 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Enzymes
  100665433 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 100665433
NCBI-ProteinID: XP_010595966
LinkDB All DBs
Position
Unknown
AA seq 556 aa AA seqDB search
MPGAWAQLLLLGLRLQLSLGFIPVEEEDPVFWNQKAAEALHTAKKLQPIQTAAKNLIIFL
GDGMGVPTVTATRILKGQLNGHLGPETSLAMDHFPYLALSKTYNVDRQVPDSAGTATAYL
CGVKANYGTIGLSAAARYNQCNTTRGNEVMSVLSRAKKAGKSVGVVTTTRVQHASPAGTY
AHTVNRNWYSDTDMPAEALNEGCQDIATQLISNTDIDVILGGGRKYMFPTGTPDPEYPDQ
SGVRADNRNLVQEWLDKHQGARYVWNRTALIQASQDTSVTHLMGLFEPADMKYDATRDTS
QDPSLTDMTEAAIRLLSRNAQGFYLFVEGGRIDHGHHASNAYMALTEAVMFDIAIERAGQ
LTSEKDTLTLVTADHSHVFSFGGYTLRGSSILGLASSKASDGKAYTSILYGNGPGYALGT
GSRPDVNESQSMLPDYKQQAAVPLSSETHGGEDVALFARGPQAHLVHGVQEQNFVAHVMA
FAACLEPYTDCGLGPSASTPSAAPPAGTTSAAPPARTTSAAPPARTTISLFLQGPERRRL
GAVLEKRLRTVLPRAG
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgccaggggcctgggcgcagctgctgctgctgggcctgaggctacagctctcactcggt
ttcatcccagttgaggaggaggacccagtcttctggaatcagaaggcagccgaggccctg
cacaccgccaagaagctgcagcccatccagacggccgccaagaacctcattatcttcctg
ggggatgggatgggggtgcccacggtgacagccacaaggatcctaaaagggcagctgaat
ggccacctggggcctgagacatccctggccatggaccacttcccatacctggctctgtcc
aagacatacaacgtggacaggcaagtgccagacagcgcaggcacggccactgcctacctg
tgtggggtcaaagccaactacgggaccatcggcctgagtgcggctgcccgctataaccag
tgcaacacgacccgcggcaatgaggtcatgtccgttctgagccgggccaagaaagcaggg
aagtccgtgggggtggtgaccaccactcgagtgcagcatgcctcaccagctggcacatat
gcacacacggtgaaccgcaactggtactcagacaccgacatgcctgccgaggcgctgaat
gagggctgccaggacatcgccacacagctcatctccaacacggacattgacgtaatcctt
ggaggaggccgcaagtacatgtttcccacggggaccccagaccctgagtacccagaccag
agtggagttagggcagacaaccgaaacctggtgcaggagtggctagacaagcaccagggt
gcccgctacgtgtggaaccgcacagcgctcatccaggcatcccaggacacctcggttaca
cacctcatgggcctctttgagccagcagacatgaaatatgatgcaacccgtgacactagc
caggacccctctctgacggacatgaccgaggcagccatccgcctgctgagcaggaacgcc
cagggcttctacctctttgtggaggggggccgcatcgaccacggtcaccacgcaagcaat
gcttacatggcactgaccgaagctgtcatgtttgacatcgccatcgagagggcgggccag
ctcacaagcgagaaggacacactgaccctcgtcaccgccgaccactcccacgtcttcagt
ttcgggggctacacactgcgtgggagctccatcttggggctggcgagcagcaaggcctca
gacggcaaggcctacacctccatcctgtacggcaacgggcccggctacgcgctcggcacc
ggctccaggcccgatgtcaacgagagccagagtatgctccccgactacaagcagcaggcc
gcggtgcccctgtcgtccgagacgcatggcggcgaggacgtggcgttgttcgcgcgcggc
ccgcaggcgcacctcgtgcacggcgtgcaggagcagaacttcgtggcgcatgtcatggcc
ttcgccgcctgcctcgagccctacacggactgcggcctggggccctctgccagtacgccc
agcgccgcgcccccagccggcaccacgagcgccgcgccccccgcccgcaccaccagcgcc
gcgcccccggcccgcaccaccatatctctctttctgcagggtcctgagcggcggcggttg
ggcgctgtgctggagaagaggctgcgcaccgtgctccccagggcgggatga

DBGET integrated database retrieval system