KEGG   Loxodonta africana (African savanna elephant): 100665497
Entry
100665497         CDS       T04351                                 

Gene name
SLC26A7
Definition
(RefSeq) anion exchange transporter
  KO
K13962  solute carrier family 26 (anion exchange transporter), member 7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100665497 (SLC26A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100665497 (SLC26A7)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC26: Multifunctional anion exchanger
   100665497 (SLC26A7)
SSDB
Motif
Pfam: Sulfate_transp STAS STAS_2 MFS_MOT1
Other DBs
NCBI-GeneID: 100665497
NCBI-ProteinID: XP_003408435
UniProt: G3THS9
LinkDB
Position
Unknown
AA seq 656 aa
MTGAKRKKKSLPWSKMRVPHCEDITRWCRRRLPVLEWAPQYNLKENLLPDTVSGLMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAVIYAIFGMGRHVCTGTFALTSLISANAVERLVP
QSSQNLTTQSNTSVLGLSEFEMRRIGVAAAVSFLGGVIQLAMFVLQLGSATFLLTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVQLEALLLSLVSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIVAASFACYCTNMEHAYGLAVVGHIPKGIPPPRAP
PMNILSAVITEAFGVALVGYVASLTLAQGSAKKFKYSVDDNQEFLAHGLSNVIPSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCVFILIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LMQVRDLKKYWKVDKIDWGIWVSTYIFTICFAANVGLLSGVVCTIAIVIGRFPRAKTVSM
KNMKEMEFKVKTEMDGDTLQQVKIFSINNPLVFLNAKKFHTDLMNLLQKENASNQPLDDI
SKCEQNMLLNSLSNGNCNDEVSQPCPNEKCCLILDCCGLTFFDYTGVSMLVEVYMECKNR
NMDIALAHCTDSLIKAMQYCGNLDSEKPIFFESVSAAISTIHSNKNVGKLGDHSEV
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgacaggggcaaagaggaaaaagaaaagcctgccctggagcaagatgcgtgtccctcat
tgtgaagacattacgaggtggtgtagaaggcggctacctgttttggagtgggcgccgcaa
tacaatctgaaagaaaacttgcttccagacaccgtgtctggattaatgttggcagttcaa
caggtgacgcaagggttggcctttgctgttctctcatctgtgcaccctgtgtttggttta
tatgggtctctgtttcctgctgtcatttatgccatatttggaatgggacgtcatgtttgc
acaggcacctttgctttaacgtccttaatatcagccaatgcagtggaacggcttgtccct
cagagcagccagaacctcaccacacagagcaacaccagtgtcctgggcttatctgaattt
gagatgcgaaggatcggtgtggctgcagcggtttccttcttgggaggagtgattcagttg
gccatgtttgtgctacaactgggcagtgccaccttcctgcttacagagcctgtcatcagt
gcgatgacaactggggctgctacccatgtcgtgacttctcaagtcaagtatctcttggga
atgaaaatgccatacatatccggaccacttggattcttctatatttatgcatatgtcttt
gaaaacatcaagtctgtccaactggaagcgttgctcttatccttggtgagcatcgtggtg
cttgttcttgttaaggagctgaatgaacagtttaaaaggaaaattaaagttgttcttcct
gtcgatttagttttgattgttgctgcatcatttgcttgttattgtaccaacatggaacac
gcatatggattagcagtggttggccatattccaaaaggaattcctccacctagagctccc
cccatgaacatcctctctgcagtaatcactgaagcttttggagtggcacttgtaggctat
gtggcctcattgactcttgctcaaggatctgccaaaaaattcaaatattcagttgatgac
aaccaggaattcttggcgcatggcctcagcaatgtgattccttcatttttcttctgcata
ccaagtgctgcagccatgggaaggactgctggcctctacagcaccggggcaaagacacag
gtggcttgtctaatatcttgcgttttcatccttatagtcatctatgcaataggaccttta
ctttattggctgcccatgtgtgttcttgcgagtattattgttgtgggactgaagggaatg
ctgatgcaagtccgggatttaaaaaaatattggaaagtggataaaattgattggggcata
tgggtcagtacatatatatttacaatatgttttgctgccaatgtaggattgctgtctggt
gttgtctgtaccatagctatagtgattggacgcttcccaagagcaaagactgtgagcatg
aaaaatatgaaagaaatggagtttaaagtgaagacagaaatggatggtgacaccttgcag
caggtgaaaattttctcaataaacaaccctcttgttttcctgaatgcaaagaagtttcac
actgatctaatgaacttactccaaaaggaaaatgccagcaaccaaccacttgatgatatt
agcaagtgtgaacagaatatgcttctcaattctctatccaatggtaactgcaatgacgag
gtctcacagccctgcccgaatgagaagtgttgtttaatcctggattgctgtggattgacc
ttttttgactatactggagtctccatgcttgttgaggtttacatggaatgtaagaacaga
aacatggacatagcattagcccattgcacagattccttgataaaagcaatgcagtactgt
ggaaacctagactcagagaaaccgatattttttgaatccgtatctgctgcaataagtacc
atccattcaaataagaatgtgggcaaacttggcgaccacagtgaagtctga

KEGG   Loxodonta africana (African savanna elephant): 100672425
Entry
100672425         CDS       T04351                                 

Gene name
SLC4A2
Definition
(RefSeq) LOW QUALITY PROTEIN: anion exchange protein 2
  KO
K13855  solute carrier family 4 (anion exchanger), member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100672425 (SLC4A2)
   04971 Gastric acid secretion
    100672425 (SLC4A2)
   04972 Pancreatic secretion
    100672425 (SLC4A2)
   04976 Bile secretion
    100672425 (SLC4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100672425 (SLC4A2)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   100672425 (SLC4A2)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Other DBs
NCBI-GeneID: 100672425
NCBI-ProteinID: XP_023403813
LinkDB
Position
Unknown
AA seq 1237 aa
MSSAPRRPASGADSFRTVKPESLSPGTPGFPEQEEDELHRTXGVERFEAILQEAGSRGAE
EPGRSYGEEDFEYHRQSSHHIHHPLSTHLPPDARRRKTPQGPGRKPRRRPGASPTGETPT
IEEGEEDEDEASEAEGARALHQPSPASTPSSVQFFLQEDDSTDRKAERTSPSPPLPPTHQ
EASPRATKGAQTGAQVEEVVSVASGTAGGDDGGASGRPLTKAQPGHRSYNLQERRRIGSM
TGAEQALLPRVPTDESEAQTLATADLDLMKSHRFEDVPGVRRHLVRKNAKGAVPGSREGR
EPGPIPRARPRTPHKPHEVFVELNELLLDKNQEPQWRETARWIKFEEDVEEETERWGKPH
VASLSFRSLLELRRTLAHGAVLLDLDQQTLPGIAHQVVEQMVISDQIKAEDRANVLRALL
LKHSHPSDEKDFSFPRNISAGSLGSLLGHHHGQGVESDPHVTEPLIGGVPETRLEVERER
ELLPPAPPAGITRSKSKHELKLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELD
AVLEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADEREDLLSAINA
FLDCSVVLPPSEVQGEELLRSVAHFQRQMLKKREEQCRLLPPGAGLEPKSAQDKALLQMV
EAVGTAEDDPLQRTGRPFGGLIRDVQRRYPHYLSDFRDALDPQCLAAVIFIYFAALSPAI
TFGGLLGEKTQDLIGVSELIMSTALQGVIFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSS
NNLEYLVGRVWIGFWLVLLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLI
KIFQEHPLHGCSVSNSSESDSGENKTWAGAGATLGPGNGSSAGQSGQGRPRGQPNTALLS
LVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILVMVLVDYSIRDTYTQKLSV
PSGFSVTAPEKRGWVINPLGETSPFPVWMMVASLLPAILVFILIFMETQITTLIISKKER
MLQKGSGFHLDLLLIVAMGGICALFGLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQ
EVKEQRVTGLLVALLVGLSMVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLM
PPKHHPDVPYVKKVRTLRMHLFTALQLLCLALLWAVMSTAASLAFPFILILTVPLRMVVL
TRIFTEREMKCLDANEAEPVFDEREGVDEYNEMPMPV
NT seq 3714 nt   +upstreamnt  +downstreamnt
atgagcagcgccccccggcgccccgcctcgggcgcagattctttccgcacagtgaagcca
gagagcctgagccctgggactcccgggttccctgagcaggaggaagatgaacttcatcgc
accnctggtgtggagcggtttgaggcaatcctacaggaggccgggtctcgaggcgcagag
gagccaggccgcagctatggggaagaagactttgagtatcaccgtcagtcctcccaccat
atccaccacccactgtctacccacctgcctccggatgcccgccgccgcaagacaccccag
ggcccaggacggaaacctcgcaggcgccctggagcttcccccactggtgaaactcccacc
attgaggaaggtgaggaagatgaggatgaagccagtgaggctgagggggcccgggcactt
caccagccatcccctgcctccacaccctcttcggtgcagttctttctccaggaggatgat
agcactgaccggaaggcagaaagaaccagtccctctccccctctgccaccgacccaccag
gaggcatctccccgggctaccaaaggggcccagactggagcccaggtggaagaggtggtg
tcagtggccagcggcacagcagggggtgacgacgggggtgcctcgggacgccccctgacc
aaagcccagcctgggcatcgcagctacaacctgcaggagaggaggcgtattgggagcatg
accggggctgagcaggcactactgccccgtgtccccacagatgagagcgaggcccagacc
ctggccacggctgacctagacctcatgaagagtcatcggttcgaggatgttcctggcgtg
aggcggcacttggtgcggaagaatgccaaaggggctgtgccaggtagcagggaagggcga
gagcctggccctatacctcgggcccggccccgaaccccccacaagccccacgaggtattt
gtggagctgaatgaattgctgttggacaaaaaccaagagcctcagtggcgggagacagct
cgctggatcaaatttgaggaagatgtggaggaggagacggagcgctgggggaagccccat
gtggcttccctgtccttccgaagtctcctggagctccgccgaaccctggcccatggggct
gtgctcttggacctggaccagcagacactgcctggcatagcccaccaggtggtggagcag
atggtcatttctgatcagatcaaggccgaggatagagccaacgtgttgcgggccctgctc
ctgaaacacagccacccaagtgatgagaaggacttctccttcccccgcaacatctcagct
ggctccctgggctccctgctgggtcatcaccatggccagggggtggagagtgacccccat
gtcactgagcctctcattggaggtgttcctgagacccggttggaggtggagcgagagcga
gagctgctccctccagccccacctgccggcatcactcgttccaagtccaagcatgagctg
aagctgctggagaagattcctgagaatgcagaagcaaccgtggtacttgtggggtgcgtg
gagttcctgtcccgccccaccatggcctttgtgcggctgcgggaggcggtggagctggac
gcagtgctcgaggtgcccgtgcccgtgcgcttcctcttcttgctgctgggcccaagcagt
gccaacatggactaccacgagatcggccgctcaatttccaccctcatgtctgacaagcaa
ttccacgaggctgcctacctggcagatgagcgggaagacctgctgagcgccatcaatgct
ttcctggactgcagcgtggtgctgcctccatctgaggtgcagggcgaggaactgctgcgc
tctgtggctcacttccagcgccagatgctcaaaaagcgggaggagcagtgccggctgttg
ccccctggggctggcctggagcccaagtctgcccaagacaaggcgctcctgcagatggta
gaggcagtaggcacagctgaagacgatccccttcagcggacaggccggccctttgggggc
ctgatccgtgatgtgcagcgccgttacccccactatctgagtgacttccgagacgcactc
gacccccagtgcctggctgctgtcatcttcatctactttgctgccctgtctcctgccatc
acctttggtggactacttggagagaagacccaagacctgattggggtatcagagctgatc
atgtccacagcactccagggcgtgatcttctgcctgctaggggctcagccgctgctagtg
atcggcttctcggggccactgctggtctttgaggaggctttcttttctttctgtagcagc
aacaacctggagtacctggtaggccgcgtgtggattggcttctggctggtgcttctggcc
ctgctcatggtggccctggagggcagcttcctggtgcgctttgtctcccgtttcactcag
gagatctttgccttcctcatctctctcatcttcatctacgagacgttctacaagctgatt
aagatcttccaggagcacccactccacggctgctcagtctccaacagctcagagtccgac
agtggcgagaataagacatgggctggggcaggagcaacgctggggccgggcaacgggagc
tcagctgggcagtctgggcaggggaggccccggggccagcccaacacggctctgctgtcg
ctggtgctcatggccggcaccttcttcatcgcctttttccttcgcaaattcaagaacagc
cggtttttccctggccggatccggcgggtgatcggggactttggggtgcccattgcaatc
ctcgtcatggtgcttgtggattacagtattcgggacacctacacacagaagctgagcgtg
cccagtgggttctcggtgacagcgccagaaaaacggggctgggtcatcaaccccctggga
gagacgagccccttccctgtgtggatgatggttgcaagcctgctgcctgccatcctggtc
ttcatcctcatcttcatggagactcagatcaccacgctgatcatctccaagaaggagcgc
atgctgcagaagggctccggcttccacctggacctgctcctcatcgtggccatgggtggc
atttgcgccctctttggcctgccctggttggctgctgccaccgtccgctccgtcacacat
gccaatgcactcactgtcatgagcaaggcagtggcgcctggggacaagcccaaaattcag
gaggtcaaggagcagcgggtgacagggctgctggttgccttgctcgtgggcctctccatg
gttatcggagatctgcttcggcagataccgctggccgtgctctttggaattttcctgtac
atgggagttacctctcttaacgggatccagttctatgaacggctgcatctgctgcttatg
ccgcccaaacaccacccagatgtcccctatgtcaagaaggttcggaccctccgtatgcac
ctgttcacagccctgcagctgctgtgcctggccctgctctgggctgtcatgtccacagct
gcctccctggccttccccttcatcctcatcctcacagtgccgctccgcatggtggtgctt
acccgcatcttcaccgagcgagagatgaaatgtctggatgcaaacgaggcggagccggtg
tttgacgagcgggagggtgtggatgagtacaacgagatgcccatgcctgtgtag

DBGET integrated database retrieval system