KEGG   Loxodonta africana (African savanna elephant): 100665518
Entry
100665518         CDS       T04351                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav03013  RNA transport
lav04012  ErbB signaling pathway
lav04066  HIF-1 signaling pathway
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04218  Cellular senescence
lav04910  Insulin signaling pathway
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05168  Herpes simplex virus 1 infection
lav05221  Acute myeloid leukemia
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100665518 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100665518 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    100665518 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    100665518 (EIF4EBP1)
   04152 AMPK signaling pathway
    100665518 (EIF4EBP1)
   04150 mTOR signaling pathway
    100665518 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100665518 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100665518 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    100665518 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100665518 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100665518 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100665518 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    100665518 (EIF4EBP1)
   05165 Human papillomavirus infection
    100665518 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100665518 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100665518 (EIF4EBP1)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100665518 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 100665518
NCBI-ProteinID: XP_003412584
UniProt: G3UHT9
LinkDB
Position
Unknown
AA seq 118 aa
MSGASGYSQTPSRTIPTTRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVAKTPPRDLPTIPGVTSPASEAPPMETRQSHLHNSPEDKPAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtcaggggccagcggctacagccagaccccgagccggaccatccccaccactcgccgg
gtggtcctcggcgacggcgtgcagctgccgcccggggactatagcaccaccccgggtggc
acactcttcagcaccaccccgggaggtaccaggatcatctatgaccggaaattcctaatg
gagtgtcgaaactcacctgtagccaaaacacccccccgggacctgcccaccattcctggg
gtcaccagccctgccagtgaggcgccccccatggaaaccaggcagagccacctacacaac
agtccagaagacaagccggcaggtggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system