KEGG   Loxodonta africana (African savanna elephant): 100665802
Entry
100665802         CDS       T04351                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03420  Nucleotide excision repair
lav04115  p53 signaling pathway
lav04120  Ubiquitin mediated proteolysis
lav05161  Hepatitis B
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05216  Thyroid cancer
lav05217  Basal cell carcinoma
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100665802 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100665802 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100665802 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100665802 (DDB2)
   05202 Transcriptional misregulation in cancer
    100665802 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100665802 (DDB2)
   05212 Pancreatic cancer
    100665802 (DDB2)
   05225 Hepatocellular carcinoma
    100665802 (DDB2)
   05226 Gastric cancer
    100665802 (DDB2)
   05214 Glioma
    100665802 (DDB2)
   05216 Thyroid cancer
    100665802 (DDB2)
   05220 Chronic myeloid leukemia
    100665802 (DDB2)
   05217 Basal cell carcinoma
    100665802 (DDB2)
   05218 Melanoma
    100665802 (DDB2)
   05213 Endometrial cancer
    100665802 (DDB2)
   05224 Breast cancer
    100665802 (DDB2)
   05222 Small cell lung cancer
    100665802 (DDB2)
   05223 Non-small cell lung cancer
    100665802 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100665802 (DDB2)
   05169 Epstein-Barr virus infection
    100665802 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100665802 (DDB2)
   03400 DNA repair and recombination proteins [BR:lav03400]
    100665802 (DDB2)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100665802 (DDB2)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100665802 (DDB2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 100665802
NCBI-ProteinID: XP_010590380
LinkDB
Position
Unknown
AA seq 464 aa
MAPRKPPETKKTLEVPKCPKGKRSRSPQELEQEAKKLFVKGPGSSRRYDSGCLWAGLANL
QVLSPYTSIVRALHQHKLGKAAWPMLQQSLQQSFLHSLASYRIFHKAAPFDRRATSLAWH
PTHPSTLAVGSKGGDILLWNFNTKDKPTFIKGIGAGGSITGLKFNPLNTNQFFTSSMEGT
TRLQDFKGNTLRVFTSSGTCNLWFCSLDVSAGSRVVVTGDNAGQVVLLNMDGKELWNLRL
HKKKVTHVALNPCCDWLLATASVDQTVKIWDLRQVRGKSSFLSSLPHRHPVNAACFSPDG
ARLLTTDQNSEIRVYSASQWDCPLGLISHPHRHFQHLTPIKATWHPRYNLIVVGRYPDPN
FKSCTPHELRTIDVFDGSSGNMMCQLYDPEYSGIISLNEFNPVGDTLASVMGYHILIWSQ
EEAGLRKRETITKVCAKQGLGATNGNKSCEKRQLSVKGLKVYKS
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggctcccaggaaacctccagaaaccaagaagacccttgaagttcctaagtgccccaag
ggcaagaggagcagaagtcctcaggagctggagcaagaggccaagaagctctttgtgaag
ggtcccggttctagcagaagatatgactcaggctgtctttgggcgggattggctaatctg
caggttctgtcgccatacaccagcatcgtcagggccctccaccagcataagctgggcaaa
gctgcctggccgatgctgcagcagagtctccagcagtcctttttgcactctctggcttct
taccggatattccacaaggccgccccctttgacaggagggccacatccttggcatggcat
ccaactcaccccagcaccctggctgtaggttccaaagggggagatatcttgctgtggaac
tttaatacaaaggacaaacccaccttcattaaagggattggagctggagggagcatcaca
gggctgaagtttaaccctctcaataccaaccagttttttacctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacactctccgagtttttaccagctcaggcacctgc
aacctctggttctgcagcctggatgtgtctgccggaagccgagtggtggtcacaggagac
aacgcagggcaagtggtcctgctgaacatggacggcaaggagctttggaatctcagactg
cacaaaaagaaagtgacccatgtggccctgaacccatgctgtgattggctcctggccaca
gcctccgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaatccagc
ttcctctcctcgctgccacacaggcatcctgtcaacgcagcttgtttcagtcctgatgga
gcccggctcctgaccactgaccagaacagcgagatccgggtttactctgcctcccagtgg
gactgccccctgggcctgatctcacaccctcaccgccacttccagcacctcacgcccatc
aaggcaacctggcatcctcggtacaacctcattgttgtgggccggtacccagatcctaat
ttcaaaagctgtactccccacgaattaaggacgatcgatgtgtttgatggaagctcaggg
aatatgatgtgtcagctctatgacccagaatattctggtatcatttcgctcaatgagttc
aatcccgtgggggacacgctggcctctgtgatgggttatcacattctcatttggagccag
gaggaagctgggttacggaagcgagagacaatcacaaaggtgtgtgccaagcaagggctt
ggagccacaaatgggaacaagtcctgtgagaagaggcagttatctgttaaagggctaaaa
gtatacaagtcttag

DBGET integrated database retrieval system