KEGG   Loxodonta africana (African savanna elephant): 100665823
Entry
100665823         CDS       T04351                                 

Gene name
USP7
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 7 isoform X1
  KO
K11838  ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav05169  Epstein-Barr virus infection
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100665823 (USP7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100665823 (USP7)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100665823 (USP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100665823 (USP7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100665823 (USP7)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100665823 (USP7)
Peptidases and inhibitors [BR:lav01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   100665823 (USP7)
Ubiquitin system [BR:lav04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100665823 (USP7)
SSDB
Motif
Pfam: USP7_ICP0_bdg USP7_C2 UCH UCH_1 MATH
Other DBs
NCBI-GeneID: 100665823
NCBI-ProteinID: XP_010595617
LinkDB
Position
Unknown
AA seq 1055 aa
MSDGHNNAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYP
DRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGF
SNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNS
LLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWET
LDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDY
YDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLM
RFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVV
YLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEV
LQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEE
KVKYTVFKVLKNSSLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKT
MIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYT
PISCKIRDLLPVMCDRAGFLQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIV
FQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVA
QRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITD
FENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSY
KIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPF
LLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQP
GNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
NT seq 3168 nt   +upstreamnt  +downstreamnt
atgagcgacgggcataacaacgcagaggaagacatggaggatgacaccagttggcgctcc
gaggccacctttcagttcactgtcgagcgcttcagcagattgagcgagtcggtccttagc
cctccgtgctttgtgcgaaatctgccgtggaagattatggtgatgccacgcttttatcca
gacagaccacaccaaaaaagcgtaggattctttctgcagtgcaatgctgaatctgattcc
acgtcgtggtcttgtcatgcgcaagctgtgctgaagataataaattacagagatgacgag
aagtctttcagccgccgtattagccatttgttcttccataaagaaaacgactggggattt
tccaattttatggcctggagtgaagtgactgatcctgagaaaggatttatagatgatgac
aaagttacttttgaagtctttgtacaggcagatgctccccatggagttgcgtgggattca
aagaagcatacaggctacgttgggttaaagaatcagggagcgacctgttacatgaacagc
ctgctgcagactttgtttttcacaaatcagctacgaaaggctgtgtacatgatgccaaca
gagggcgatgattcatctaaaagcgtccctttagcattacaaagagtgttctatgaatta
cagcacagtgataaacctgtaggaacaaaaaagctaacaaagtcattcgggtgggagact
ttagacagcttcatgcagcatgatgttcaagagctctgtcgagtgttgcttgataatgtg
gaaaataagatgaaaggcacgtgtgtagaaggcaccatacctaaattattcagaggcaag
atggtgtcctacatccaatgtaaagaagtagactatcggtctgatagaagagaggattat
tatgatatccagctgagtataaaaggaaagaaaaacatcttcgaatcatttgtggattat
gtggcagtagaacaactagacggtgacaataaatacgatgccggggagcatggcttgcag
gaagcagagaaaggtgtgaaattcctaacattgccaccagtgttacatctacaactgatg
agatttatgtatgaccctcagacggaccaaaatatcaagatcaatgataggtttgagttc
cccgagcagttaccactggatgaatttttgcaaaaaacggatcctaaggaccctgccaat
tatattcttcatgcagtcctggttcacagtggtgataaccatggcggacattacgtggtt
tatctgaaccccaaaggggacggcaaatggtgtaaatttgatgacgatgtggtatcaagg
tgcactaaagaagaagccatcgaacacaattacgggggccatgacgatgacctgtctgtc
cgacactgcactaacgcctacatgttagtttatatcagggaatcaaagctgagtgaagtt
ttacaagctgtcacagaccacgatattcctcagcagctggtggagcgactgcaggaagag
aaaaggatcgaggcgcagaagcggaaggagcggcaggaagcccatctctacatgcaagtg
cagatagtcgccgaggaccagttttgtggccaccaaggaaatgacatgtacgatgaagaa
aaagtaaaatacactgtgttcaaagtgttgaaaaactcctcgctcgccgagtttgttcag
aacctctcccagaccatgggatttccacaagatcaaattcgattatggcccatgcaagca
aggagtaatggaacaaaacgaccggcaatgttagataatgaagctgatggtaataaaaca
atgattgaactcagcgataatgaaaacccttggacaatattcctggaaacagttgatcct
gagctggctgctagtggggcaacgttacccaagtttgataaagatcatgatgtgatgtta
tttctgaagatgtatgatcccaaaacacgaagcttgaattattgcgggcatatctacaca
ccaatatcctgtaaaatacgtgacttgctcccagttatgtgtgacagagcaggatttctc
caggatactagtcttatcctctatgaggaagttaaaccgaatttaacagagagaatccag
gactatgacgtgtctcttgacaaagcccttgatgaactaatggatggtgacatcatagtg
tttcagaaggatgaccccgaaaacgataacagtgaattacccaccgcaaaggaatatttc
agagacctctaccaccgtgtcgatgtcattttctgtgataaaacaatccctaatgatcct
ggatttgttgttacgttatccaatagaatgaattattttcaggtggcaaagacagttgca
cagaggcttaacacagaccccatgttgctccagtttttcaagtctcaaggttatagggat
ggcccaggtaatcctcttagacataattatgaaggtactttaagagatcttctacaattc
ttcaagcctagacaacctaagaaactttactatcagcagctgaaaatgaaaatcacagac
ttcgaaaacaggcgaagttttaaatgtatatggttaaacagccaatttagggaagaggaa
ataacactatatccagacaagcacggctgtgtccgggacctgctagaagaatgtaaaaag
gctgtagagctcggggagaaagcatcagggaaacttaggctgctagaaattgtaagctac
aaaattattggtgtgcatcaagaagatgaactattagaatgtttatcccctgcaacgagt
cgaacgtttcgaatagaggaaatacctttggaccaggtagacatagacaaggaaaacgag
atgctgatcacagtggcacatttccacaaagaggttttcggaacgtttggaatcccgttt
ttgctgaggatacaccagggcgagcatttccgagaagtgatgaagcggatccagagtctg
cttgacatccaggagaaggaatttgaaaagtttaaatttgcaattgtaatgatgggccga
caccagtacataaacgaagatgagtatgaagtaaacttgaaagactttgagcctcagccc
ggcaacatgtctcaccctcggccttggctagggcttgaccacttcaacaaagcccccaag
aggagtcgctacacttaccttgagaaggctattaaaatccataactga

DBGET integrated database retrieval system