KEGG   Loxodonta africana (African savanna elephant): 100665874
Entry
100665874         CDS       T04351                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04110  Cell cycle
lav04151  PI3K-Akt signaling pathway
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04350  TGF-beta signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04630  JAK-STAT signaling pathway
lav04919  Thyroid hormone signaling pathway
lav05132  Salmonella infection
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05213  Endometrial cancer
lav05216  Thyroid cancer
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100665874 (MYC)
   04012 ErbB signaling pathway
    100665874 (MYC)
   04310 Wnt signaling pathway
    100665874 (MYC)
   04350 TGF-beta signaling pathway
    100665874 (MYC)
   04390 Hippo signaling pathway
    100665874 (MYC)
   04630 JAK-STAT signaling pathway
    100665874 (MYC)
   04151 PI3K-Akt signaling pathway
    100665874 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100665874 (MYC)
   04218 Cellular senescence
    100665874 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100665874 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100665874 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100665874 (MYC)
   05202 Transcriptional misregulation in cancer
    100665874 (MYC)
   05206 MicroRNAs in cancer
    100665874 (MYC)
   05205 Proteoglycans in cancer
    100665874 (MYC)
   05230 Central carbon metabolism in cancer
    100665874 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100665874 (MYC)
   05225 Hepatocellular carcinoma
    100665874 (MYC)
   05226 Gastric cancer
    100665874 (MYC)
   05216 Thyroid cancer
    100665874 (MYC)
   05221 Acute myeloid leukemia
    100665874 (MYC)
   05220 Chronic myeloid leukemia
    100665874 (MYC)
   05219 Bladder cancer
    100665874 (MYC)
   05213 Endometrial cancer
    100665874 (MYC)
   05224 Breast cancer
    100665874 (MYC)
   05222 Small cell lung cancer
    100665874 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100665874 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100665874 (MYC)
   05161 Hepatitis B
    100665874 (MYC)
   05160 Hepatitis C
    100665874 (MYC)
   05163 Human cytomegalovirus infection
    100665874 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100665874 (MYC)
   05169 Epstein-Barr virus infection
    100665874 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100665874 (MYC)
   03019 Messenger RNA biogenesis [BR:lav03019]
    100665874 (MYC)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100665874 (MYC)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100665874 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 100665874
NCBI-ProteinID: XP_010586790
LinkDB
Position
Unknown
AA seq 437 aa
MPLNVSFANRNYDLDYDSVQPYFFDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPL
SPSRRSGLCSPSYNLAFASFSPGGDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDD
ENFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPSPARGHGGCSTSSLYLQDL
SAAASECIDPSVVFPYPLNDGNSPKPCASPDSTAFSPSSDSLLSSAESSPLASPEPRALH
EETPPTTSSDSEEEQEDEEIDVVSVEKRQPPAKRSEAGSPPTGGHSKPPHSPLVLKRCHV
STHQHNYAAPPSTRKDYPATKRAKLDSGRVLKQISNNRKCTSPRSSDTEENDKRRTHNVL
ERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQAEEQKLISEKDLLRK
RREQLKHKLEQLRNSCE
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaggaactatgacctggactacgactcagtgcag
ccgtatttctttgacgaggaggagaacttctaccagcagcagcagcagagcgagctgcag
ccgccagcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccacccctg
tccccaagccgccgctccgggctctgctcgccctcctacaacctggccttcgcctccttc
tccccgggaggagacgacggcggcggcggcagcttctccaccgccgaccagttggagatg
gtgaccgagctgctggggggagatatggtgaaccagagcttcatctgcgacccggacgac
gagaacttcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggccgcg
gccaagctggtctccgagaagctggcctcttaccaggctgcgcgcaaagacagcggcagt
ccgagccccgcccgcggccacggcggctgctccacctccagtctgtacctgcaggacctg
agcgccgctgcctccgagtgcatcgacccctcggtcgtcttcccctacccgctcaacgac
ggcaactcgccgaagccctgcgcctcgccagactccaccgccttctctccgtcctcggac
tctctgctgtcctccgcggagtcctcccctctggccagccccgagccccgggcgctccac
gaggagacaccccccacgaccagtagcgactctgaggaagaacaagaagatgaggaaatt
gatgtcgtctctgtggaaaagaggcagccccctgccaaaaggtcagaagcgggatcgccc
cctactggaggccacagcaaacctcctcacagcccgctggtcctcaagcgatgccatgtc
tccactcatcagcacaactatgcagccccaccctccaccaggaaagactaccccgccacc
aagagggcgaagttggacagtggcagagtcctgaaacagatcagcaacaaccgcaaatgt
accagcccccggtcttcggacaccgaggagaacgacaagaggcggacacacaacgtcttg
gaacgccagaggaggaacgagctgaaacggagcttttttgcccttcgagaccagatccca
gagttggaaaacaatgaaaaggcccccaaggtagtcatccttaaaaaagccacagcgtac
atcttgtccatccaagcagaggagcaaaagctcatttcagaaaaggacttgttgcggaaa
cggcgagaacagttgaaacacaaacttgaacagctacggaactcttgtgaataa

DBGET integrated database retrieval system