KEGG   Loxodonta africana (African savanna elephant): 100665908
Entry
100665908         CDS       T04351                                 

Gene name
EIF2AK2
Definition
(RefSeq) interferon-induced, double-stranded RNA-activated protein kinase isoform X2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04141  Protein processing in endoplasmic reticulum
lav04217  Necroptosis
lav05010  Alzheimer disease
lav05160  Hepatitis C
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100665908 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100665908 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100665908 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100665908 (EIF2AK2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100665908 (EIF2AK2)
   05171 Coronavirus disease - COVID-19
    100665908 (EIF2AK2)
   05164 Influenza A
    100665908 (EIF2AK2)
   05162 Measles
    100665908 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    100665908 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100665908 (EIF2AK2)
   05169 Epstein-Barr virus infection
    100665908 (EIF2AK2)
   05165 Human papillomavirus infection
    100665908 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100665908 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100665908 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100665908 (EIF2AK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100665908 (EIF2AK2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   100665908 (EIF2AK2)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100665908 (EIF2AK2)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     100665908 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm DND1_DSRM Kinase-like Kdo FTA2
Other DBs
NCBI-GeneID: 100665908
NCBI-ProteinID: XP_010594172
LinkDB
Position
Unknown
AA seq 548 aa
MASGLSAGFFMEELNKYSQKHDVPVKYLELSKTGPPHDLRFTFQVIIKDREFPAAEGKTK
KIAKNAAAKIAYEIINKENKTVSSISLLTADTSEGLSIGNYIGLVNRFAQKTQLSVNYVQ
CFVSEPRESDVRSSPRFHYTCRIGSKEYGIAAGSTKQEAKQFAAKLAYDEITGEKTSEKA
DSASFGSFVTSPSDSSGVSFETSTSSIELVPENGLSASESEQKHSSDSSKDSSSSSVDSL
RNNQRKVKRNLAPRFDCLKAGAVGNTKHTMDSRFVKDFEEIEPIGSGGYGDVFKAKHRID
KKTYVIKRVKYNNEKVEREVKALANLNHANIVHYHYCWDGYDYDPENSTNNSRSVTKCLF
IQMEFCDKGTLEQWIESRRGKQSDKDLALDLFEQITKGVAYIHSQRLIHRDLKPSNIFLV
HIKQVKIGDFGLVTSLKNDEKRTVDKGTWRYMSPEQMSLQEYGNEVDIFALGLILAELLH
ICTTVQETVKIFNDLRQGIFPDVFDTKEKNLLQKLLSKDPKERLKAPEILKTLKKWKNDP
EEKKSKSC
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggccagtggtctttcagcaggtttcttcatggaggaacttaataaatacagtcaaaag
catgatgtaccagttaaatatcttgaactgtctaaaacaggacctccacatgacttaagg
tttacatttcaagttattataaaggacagagaatttccagcagctgaaggtaaaacaaag
aagatagcaaaaaatgctgcagctaaaatcgcctatgagataattaataaagaaaataag
acggtcagctctatatcactgctgacagcagacacttcagaagggctatccattgggaat
tacataggtcttgtcaatagatttgcccagaagacacaactctctgtaaattatgtacaa
tgttttgtgagcgaaccaagggagtccgacgtcagaagttctcctagatttcattatact
tgtcgaattgggtcgaaagaatatggtattgctgctggttctactaaacaggaggcaaaa
caatttgctgccaaactcgcatatgatgagataacaggagaaaaaacatcagagaaagct
gactcagcatcgtttggttctttcgtgacttcacccagtgactccagtggcgtttctttt
gagacgagcacatcctctattgaattagtacctgaaaatggattatcagccagtgaatct
gaacaaaagcacagcagtgacagttcaaaagattcttcttcatcttctgtggacagtctc
agaaataatcaaaggaaggtaaaaagaaatttggcgcctagatttgattgtcttaaggca
ggagcagtcgggaataccaagcatactatggactccaggtttgttaaggattttgaagaa
atagaaccaattggctcaggtggatatggcgacgttttcaaagcaaaacacagaattgat
aagaagacttatgttattaaacgtgttaaatataataatgagaaggtagagcgggaagta
aaagcattggcgaatcttaatcatgcaaatattgttcactaccattattgttgggacgga
tatgactatgatccagaaaacagcacaaataattcaaggtcagtgactaaatgtcttttc
atccaaatggagttctgtgataaagggacactggagcaatggatcgaaagcagaagaggc
aagcaatcagacaaagatttggctttggatttatttgagcaaataacaaaaggagtggct
tatatacattcacaacggttaattcatagagaccttaagccaagtaacatatttttagta
catataaaacaagtaaagattggagactttggacttgtaacatccttgaaaaatgatgaa
aagcgaacagttgacaagggaacatggcgatacatgagcccagaacagatgtctttacaa
gaatatggaaatgaagtggacatctttgctttggggctaattcttgctgagcttcttcac
atatgtactactgttcaggaaacagtcaagatttttaacgatctaaggcaaggcatcttc
ccagatgtatttgataccaaggaaaaaaatcttctacaaaaattactctcaaaagatccc
aaggaacgacttaaggcacctgaaatactgaagaccttgaaaaagtggaaaaatgatcca
gaggaaaagaagtcaaagtcatgttag

DBGET integrated database retrieval system