KEGG   Loxodonta africana (African savanna elephant): 100665933
Entry
100665933         CDS       T04351                                 

Gene name
PLN
Definition
(RefSeq) cardiac phospholamban
  KO
K05852  phospholamban
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04919  Thyroid hormone signaling pathway
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100665933 (PLN)
   04024 cAMP signaling pathway
    100665933 (PLN)
   04022 cGMP-PKG signaling pathway
    100665933 (PLN)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100665933 (PLN)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100665933 (PLN)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100665933 (PLN)
Transporters [BR:lav02000]
 Other transporters
  Pores ion channels [TC:1]
   100665933 (PLN)
SSDB
Motif
Pfam: Phospholamban Sarcolipin EloA-BP1
Other DBs
NCBI-GeneID: 100665933
NCBI-ProteinID: XP_023395704
LinkDB
Position
Unknown
AA seq 52 aa
MEKVQHLTRSAIRRASTIEVPQQARQNFQNLFINFCLILICLLLICIIVMLL
NT seq 159 nt   +upstreamnt  +downstreamnt
atggagaaagtccaacacctcactcgctccgctataaggagagcttccaccattgaagtg
cctcaacaggcacgccaaaacttccagaacctgtttatcaatttctgtctcatcttaata
tgcctcttgctgatctgcatcattgtgatgcttctctga

DBGET integrated database retrieval system