KEGG   Loxodonta africana (African savanna elephant): 100665944
Entry
100665944         CDS       T04351                                 

Gene name
PPP1R1A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 1A
  KO
K08050  protein phosphatase 1 regulatory subunit 1A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04720  Long-term potentiation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100665944 (PPP1R1A)
  09156 Nervous system
   04720 Long-term potentiation
    100665944 (PPP1R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100665944 (PPP1R1A)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100665944 (PPP1R1A)
SSDB
Motif
Pfam: DARPP-32
Other DBs
NCBI-GeneID: 100665944
NCBI-ProteinID: XP_023395161
LinkDB
Position
Unknown
AA seq 167 aa
PRGAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPLLKSTLSMSPRQRKKVTRTTPTMK
ELQMMVEHHLGQQQQGEEPEGAAESTGPQESCPPGITGTEAESRLSTSGTAPKPAGAIPK
TQERASEEPSTEEPSTHTQPSDSQGTNLRLDKGTETYIRHQNNLPSS
NT seq 504 nt   +upstreamnt  +downstreamnt
ccccgaggcgcagagcagattcggaggcgccgccccacccctgccaccctcgtgctgacc
agtgaccagtcctccccagagatagatgaagaccggatccccaacccacttctcaagtcc
actttgtcaatgtctccacggcagcggaagaaggtgacaaggaccacacccacaatgaaa
gagctgcagatgatggttgaacatcacctggggcaacagcagcagggagaggagcctgag
ggagctgcagagagcacagggcctcaggagtcctgcccacctgggatcacaggcacagaa
gcagagtcaaggctgagcacctctgggacagcaccaaagcctgcaggagccatccctaag
actcaggagagggccagtgaggaacccagcacagaggagccctccacccatacacaacca
tcggattcccagggaaccaacttgagattggacaaggggacagagacatacatcagacat
cagaacaaccttcccagcagttag

DBGET integrated database retrieval system