KEGG   Loxodonta africana (African savanna elephant): 100666208
Entry
100666208         CDS       T04351                                 

Gene name
CHEK2
Definition
(RefSeq) serine/threonine-protein kinase Chk2 isoform X1
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04218  Cellular senescence
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100666208 (CHEK2)
   04115 p53 signaling pathway
    100666208 (CHEK2)
   04218 Cellular senescence
    100666208 (CHEK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100666208 (CHEK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100666208 (CHEK2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lav03400]
    100666208 (CHEK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100666208 (CHEK2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   100666208 (CHEK2)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100666208 (CHEK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like Kdo Pkinase_fungal YrbL-PhoP_reg RIO1 APH
Other DBs
NCBI-GeneID: 100666208
NCBI-ProteinID: XP_003419208
LinkDB
Position
Unknown
AA seq 565 aa
MSREADMDCQQSQDGTSSQSQGATSSQSATSSQPAFSSSWQSHSSSLQSPGLSSQPHGSS
QSQNTSGSSSGTVHTSSQSSHSSSGTLSSVDTVSTQELYSIPEDQEPEEPIPAPWARLWA
LQDGFSNLECVNDNYWFGRDRSCEYCFDEPLLKRTDKYRTYSKKHFRIFREMGPKNSYIA
YIEDHSGNGTFVNRELVGKGRRLPLNNNCEIALSVWNNKVFVFFDLTVDDQSVYPKELRD
QYIMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILK
KLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDRVVGNRRLKEATCKLYFYQMLLAVQYL
HENGIIHRDLKPENVLLSSQKEDCLIKITDFGQSKILGETSLMRTLCGTPTYLAPEVLVS
FGTAGYNRAVDCWSLGVILFICLSGYPPFSEHKTQVSLKDQITSGKYNFIPEVWAEVSEK
ALDLVKKLLVVDPKERFTTEDALRHPWLQDEDMKRKFEDLLLEENKSTPVPQVPTQPSTS
RKRPLEGEVEDTDTPKRLAVCAAVS
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgtctcgagaggcagatatggattgtcagcagtcccaagacggcacctcctcacagtct
caaggcgccacctcctctcagtccgccacctcctctcagcccgccttctcctcctcctgg
cagtcgcacagcagctccttgcagtcccctggcctttcctcacagccccacggctcttcg
cagtcccagaacacatctggctcctcctctggcacagtacacacatccagtcagtcctct
cactccagctccgggacgctgagttccgtagacacagtgtccactcaggaactctactct
attcccgaggaccaagaaccagaggagcccatcccggccccctgggctcgattatgggcc
cttcaggatggattctccaatctcgagtgtgttaatgacaactactggtttgggagagac
agaagctgtgaatattgcttcgatgagccactgctgaaaagaacagacaaataccggaca
tatagcaagaaacactttcggattttcagagaaatgggtcctaaaaactcttacatcgca
tacatagaagatcacagtgggaatggaacctttgtaaatagagagcttgtagggaaagga
agacgccttccgttgaataacaattgtgaaattgcactttcagtatggaataataaagtt
tttgtattttttgatctgactgtagatgaccagtcagtttatcctaaagaattgagagac
caatacatcatgtcaaaaacccttggaagtggtgcctgtggagaggtgaagctcgctttt
gagaggaaaacatgtaagaaagtagctataaagatcatcagcaaaaggaagtttgctatt
ggctctgcgagagaggcagatccagctctcaatgttgaaacagaaatagaaatactgaaa
aagctaaatcatccttgcatcatcaagattaaaaacttttttgatgcagaagactattat
attgttttggaattgatggaaggaggagagctgtttgacagggtggtgggaaacagacgc
ctgaaagaagctacctgcaaactctatttttaccagatgcttctggctgtacagtacctt
catgaaaatggcattatacatcgggacttaaagccagagaatgttctactctcatcacag
aaagaggactgtcttataaagattactgattttgggcagtccaagattctgggggagacc
tctctcatgagaactttatgtggtacccccacctatttggctcctgaggttcttgtttcc
tttgggactgccgggtataaccgtgctgtggactgctggagtttaggagttatccttttt
atttgccttagtgggtatccacctttctctgagcataagactcaagtgtcactgaaggat
cagatcaccagtggaaaatacaacttcattcctgaagtctgggcagaggtctcagagaag
gctctcgaccttgtcaaaaagttgttggtagtggatcccaaggagcgttttaccacagaa
gatgccttaagacacccatggcttcaggatgaggacatgaagagaaagtttgaagacctg
cttttggaagaaaataaatcgacgcctgtaccccaggtcccaacgcagcctagcactagc
cgaaagcgaccgcttgaaggggaagtggaggatactgacaccccaaagcgcctggctgtg
tgtgccgctgtctcgtga

DBGET integrated database retrieval system