KEGG   Loxodonta africana (African savanna elephant): 100666297
Entry
100666297         CDS       T04351                                 

Gene name
TRPV4
Definition
(RefSeq) LOW QUALITY PROTEIN: transient receptor potential cation channel subfamily V member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04218  Cellular senescence
lav04750  Inflammatory mediator regulation of TRP channels
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100666297 (TRPV4)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100666297 (TRPV4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100666297 (TRPV4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666297 (TRPV4)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100666297 (TRPV4)
SSDB
Motif
Pfam: Ion_trans Ank_2 Ank Ank_3 Ank_4
Other DBs
NCBI-GeneID: 100666297
NCBI-ProteinID: XP_023415267
LinkDB
Position
Unknown
AA seq 738 aa
MVRGQRPSPPNTLPPHPSRKQPQSPKAPAPQPPPVLKVFNRPILFDIVSRGSTTDLDGLL
PFLLTHKKRLTDEEFREPSTGKTCLPKALLNLSNGRNDTIPLLLDIAERTGNMREFINSP
FRDVYYRGQTALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLS
LGACTNQPHIVNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLL
LKCARLFPGSNLEAVLNNDGLSPSDDGRQTAKIGVFQHIIRREVTDEDTRHLSRKFKDWA
YGPVYSSLYDLSSLDTCGEEASVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVS
FYISVVSYLCAMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEIITLFTGVLFFFTNIK
DLFMKKCPGVNSLFIDGSFQLLYFIYSVLVIVSAALYLAGIEAYLAVMVFALVLGWMNAL
YFTRGLKLTGTYSIMIQKILFKDLFRFLLVYLLFMIGYASALVSLLNPCANMKVCNQDQT
NCSVPTYPSCRDSETFSTFLLDLFKLTIGMGDLEMLSSAKYPVVFIILLVTYIILTFVLL
LNMLIALMGETVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDG
TPDRRWCFRPVSVIGPSLREDGAVEADRWSSXVPRVVELNKSSNQDEVVVPLDTMGNPSC
DSHQQSYPPKWRTDNAPL
NT seq 2217 nt   +upstreamnt  +downstreamnt
atggtgcgtggacagaggccaagccctcctaacaccctgcctcctcacccatctaggaag
cagccacagagccccaaagctcccgcgccccagccaccccccgtcctcaaagtcttcaac
cggcccatcctctttgacatcgtgtcccggggctctaccaccgacctggacgggctgctc
ccattcttgctgacgcacaagaagcgcctgaccgatgaggagtttcgagagccgtccacg
gggaagacctgcctgcccaaggccctgctgaacctgagcaatggccgcaatgacaccatc
cccttgctcctggacatcgccgagcgcacgggcaacatgcgcgaattcatcaactcgccc
ttccgggacgtctactaccgaggtcagaccgccctgcacattgccatcgagcgccgctgc
aaacactatgtggagcttcttgtggcccaaggggctgatgtccacgcccaggcccgaggg
cgcttcttccagcctaaggatgaaggtggctacttctactttggcgagctgcccctttcg
ctgggtgcctgcaccaaccagccccacatcgtcaactacctgacggagaacccccacaag
aaggcagacatgcggcggcaggactcacgcggcaacacggtgctccacgcgttggtggcc
attgccgacaacacccgcgagaacaccaagttcgtcaccaagatgtatgacctgctgctg
ctcaagtgtgcccgcctcttccctggcagcaacctggaggccgtgcttaacaacgatggc
ctctcgccctctgatgatggccgccagacggccaagatcggggtatttcagcatatcatt
cggcgggaggtgacggacgaggacacgcgacacctgtcccgcaagttcaaggattgggcc
tacggaccagtgtattcctcactctacgacctctcctccctggacacgtgtggggaagag
gcctccgtattggagatcctggtgtataacagcaagatcgagaaccgccatgagatgctg
gccgtggagcccatcaatgagctactgcgggacaagtggcgcaagttcggagctgtttcc
ttctacatcagcgtggtctcctacctgtgcgccatggtcatcttcaccctcactgcctac
taccagccactggagggcactccgccatatccttaccgcacgacagtggactacctgagg
ctggctggcgaaatcatcaccctcttcactggggttctgttctttttcaccaatatcaaa
gacttgttcatgaagaaatgccctggtgtgaactctctgttcatcgatggctccttccag
ctgctctacttcatctattctgtgctggtgattgtctcagcggccctctacctggcgggg
attgaggcctacttggccgtcatggtctttgccctggtcctgggctggatgaacgccctg
tacttcacccgtgggctgaagctgacgggaacctatagcatcatgatccagaagatcctc
ttcaaagaccttttccgcttcctgctcgtctacttgctcttcatgatcggctatgcctca
gccctggtctccctcctgaacccttgtgccaacatgaaggtgtgcaaccaggaccagacc
aattgctcagtgcccacctacccctcgtgccgcgacagcgagaccttcagcaccttcctc
ctggacctcttcaagctgaccatcggcatgggcgacctggagatgctgagcagcgccaag
taccccgtagtcttcatcatcctgctggtcacctacatcatcctcacctttgtactgctc
ctcaacatgctcattgccctcatgggggagacggtgggccaggtctccaaggagagcaag
catatctggaagctgcagtgggccaccaccatcctggacatcgagcgctcctttcccgtg
ttcttaagaaaggccttccgctccggagagatggtgactgtgggcaagagctcagacggc
actccagaccgcaggtggtgcttcaggcctgtgtcagtcatcggcccctcgctcagggaa
gatggagctgtggaggcggatcgttggtcttcgngtgtaccccgcgtggtggagctgaac
aagagttcgaaccaggatgaggtggtggtgcctcttgacaccatggggaatcccagctgt
gacagccaccaacagagttacccccccaagtggaggaccgacaacgcccccctctag

DBGET integrated database retrieval system