KEGG   Loxodonta africana (African savanna elephant): 100666496
Entry
100666496         CDS       T04351                                 

Gene name
CHRM2
Definition
(RefSeq) muscarinic acetylcholine receptor M2
  KO
K04130  muscarinic acetylcholine receptor M2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04725  Cholinergic synapse
lav04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100666496 (CHRM2)
   04024 cAMP signaling pathway
    100666496 (CHRM2)
   04151 PI3K-Akt signaling pathway
    100666496 (CHRM2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100666496 (CHRM2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100666496 (CHRM2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100666496 (CHRM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100666496 (CHRM2)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    100666496 (CHRM2)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 100666496
NCBI-ProteinID: XP_003420271
UniProt: G3UBP4
LinkDB
Position
Unknown
AA seq 501 aa
MCFIAMLMLHLLILFCFPTGLNVYLATWLLVGEHKMNNSTNSSNDGLALTSPYKTFEVVF
IVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTV
IGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIA
AAWVLSFILWAPAILFWQFVVGVRTVKDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVL
YWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKA
PRDAVTENCVQGEEKESSNDSTSVSAIASNMRDDEITQDENTVSTSLGHSKDENSKQTCI
KIGTKIQKGDVCTPSNATVELIASAGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKV
TRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNA
TFKKTFKHLLMCHYKNIGATR
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgtgttttatagcaatgcttatgttacacttgttaattttattctgtttccctacaggt
ttaaatgtttacttggctacttggctactggttggagaacacaaaatgaataactcaaca
aactcctctaacgatggactggctctgaccagcccttataagacctttgaagtagtcttt
attgtccttgtggctggatcccttagcttggtgaccatcattgggaacatcctggtcatg
gtctccattaaagtcaaccgccacctccagactgtcaacaattacttcttgttcagcttg
gcctgtgctgacctcatcataggtgttttctccatgaacttgtatactctctacactgtg
attggctactggcctttggggcctgtggtgtgtgacctctggctagccctggactatgta
gtcagcaatgcctcagttatgaatctgctcatcatcagctttgacaggtacttctgcgtc
accaagcctctgacctaccccgtcaagcggaccacgaaaatggcagggatgatgatcgct
gctgcctgggtcctctccttcatcctctgggccccagccattctcttctggcagtttgtc
gtaggagtgagaactgtgaaggatggtgaatgctacatccagtttttttccaacgctgct
gtcacctttggcacagccatcgcagccttctatttgccagtgatcatcatgactgtgcta
tactggcacatatcccgagccagcaagagcaggataaagaaggacaagaaggagcctgtg
gccaaccaagatccagtttctccaagtctggtgcaagggaggatagtgaagccgaacaac
aacaacatgcccagcagtgacgatggcctggagcacaacaaaatccagaatggtaaggcc
cccagagatgctgtgactgaaaactgtgtccaaggggaggaaaaagagagctccaatgac
tccacctcggtcagtgccatcgcctctaacatgagagatgatgaaataacccaggacgaa
aacacagtctcgacttccctgggccattccaaagacgagaactctaagcaaacatgcatc
aaaattggcaccaagatccaaaaaggggatgtatgtaccccatctaatgccactgtggag
ctaattgcttctgcaggtcagaatggagacgaaaagcagaacatcgtagcccgcaagatt
gtgaagatgactaagcagcctgccaaaaagaagcctcctccttcccgggaaaagaaagtg
acgaggacaatcttggccattctgctggctttcatcatcacttgggccccatataatgtc
atggtgctcatcaacaccttctgtgcaccctgcatccccaacacggtgtggacaattggt
tactggctctgttacatcaatagcactatcaaccccgcctgctatgcactttgtaatgcc
accttcaagaagacctttaaacaccttctcatgtgtcattacaaaaacataggtgccaca
aggtaa

DBGET integrated database retrieval system