KEGG   Loxodonta africana (African savanna elephant): 100666513
Entry
100666513         CDS       T04351                                 

Definition
(RefSeq) lysozyme C, kidney isozyme isoform X1
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100666513
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100666513
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100666513
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100666513
SSDB
Motif
Pfam: Lys SLT_3 SLT
Other DBs
NCBI-GeneID: 100666513
NCBI-ProteinID: XP_003405246
UniProt: A0A077SA26
LinkDB
Position
Unknown
AA seq 148 aa
MKALLILGLLFLSGTAQGKVFERCELARTLKRYGMDGFRGISLANWMCLTKWESDYNTQA
TNYNPGDKSTDYGIFQINSHYWCNDGKTPRAVNACGISCYALLQDDITQAVACAKRVVSD
PQGIRAWVAWRNHCQNHDVTQYIQGCGV
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaggctctccttattctgggccttctcttcctttctggcactgcccagggcaaggtc
tttgaaaggtgcgagttggccagaactctgaaacggtatggaatggatggcttcaggggg
atcagcctggcaaactggatgtgtttgaccaaatgggagagtgattacaacacccaagct
acaaactacaatcctggagacaaaagcactgattacgggatttttcagatcaatagccac
tactggtgtaatgatggcaaaaccccaagagcagttaacgcctgtggcatatcctgctac
gctttgctgcaagatgatatcactcaagctgtagcttgtgcgaaaagggttgtcagtgat
ccacaaggcattagagcatgggtggcatggagaaaccattgtcagaaccacgatgtcact
cagtacattcaaggctgtggagtctaa

KEGG   Loxodonta africana (African savanna elephant): 100666538
Entry
100666538         CDS       T04351                                 

Definition
(RefSeq) lysozyme-like protein 1
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100666538
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100666538
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100666538
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100666538
SSDB
Motif
Pfam: Lys SLT_3 SLT
Other DBs
NCBI-GeneID: 100666538
NCBI-ProteinID: XP_023404583
LinkDB
Position
Unknown
AA seq 148 aa
MKAVSILALIGCVATVVESKVYTRCKLAKIFSRAGLDNYRGFSLGNWICLAYYESHYNTT
AQNVLDDGSIDYGIFQINSYTWCRSGTLQQKNHCHVACSALITDDLTDAIICAKKIVKET
EGMNYWQGWRKYCKGKDLTEWKKGCEVS
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaggctgtcagcatcctggccctgataggctgtgtggccacggtcgtcgagtccaaa
gtctacactcgctgtaaactggcaaaaatattttcgagggctggcctggacaattaccgg
ggttttagccttggaaactggatctgcctggcgtactatgagagtcactataacaccacg
gcccagaatgtactggatgacggtagcatcgactatggcatttttcagataaacagttac
acgtggtgcaggagcgggacactacagcagaagaaccattgtcatgttgcctgctcagcc
ttgatcactgacgacctcacagatgcaattatctgtgccaagaaaattgtgaaagaaaca
gaagggatgaactattggcaaggctggaggaaatactgtaagggcaaagacctgaccgaa
tggaagaagggatgtgaggtttcatga

KEGG   Loxodonta africana (African savanna elephant): 100666797
Entry
100666797         CDS       T04351                                 

Definition
(RefSeq) lysozyme C-like
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100666797
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100666797
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100666797
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100666797
SSDB
Motif
Pfam: Lys SLT
Other DBs
NCBI-GeneID: 100666797
NCBI-ProteinID: XP_023395422
LinkDB
Position
Unknown
AA seq 146 aa
MKALLILGLLFLCGTVHGKVFKSQIYLYTYNISDLVLLTYYFSGVCLAKHESNYKTRTTN
YNPGDKSTDYGIFQINSRYWCNDGKTPNAVNACGISCYDLLQGDITQAVACAKRVVRDPQ
GIKAWVAWRKHCQNRDLTQYVRGCGV
NT seq 441 nt   +upstreamnt  +downstreamnt
atgaaggctctccttattctggggcttctcttcctttgtggcactgtccacggtaaggtc
tttaaaagtcaaatatatctttacacttacaatataagtgatttggtgttgctcacttat
tacttttcaggggtgtgtttggccaaacatgagagtaattacaagacccgaactacaaac
tataatcctggagacaaaagcactgattacgggatttttcagatcaatagccgctactgg
tgtaatgatggcaaaaccccaaacgcagttaatgcctgtggcatatcttgctacgattta
ctgcaaggtgatatcactcaagctgtagcttgtgcaaagagagttgtcagggatccacaa
ggcattaaagcatgggtagcatggagaaaacattgtcagaaccgtgatctcactcagtat
gttcgaggctgtggggtttaa

KEGG   Loxodonta africana (African savanna elephant): 100666803
Entry
100666803         CDS       T04351                                 

Definition
(RefSeq) lysozyme C-like
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100666803
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100666803
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100666803
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100666803
SSDB
Motif
Pfam: Lys SLT SLT_3
Other DBs
NCBI-GeneID: 100666803
NCBI-ProteinID: XP_010584661
LinkDB
Position
Unknown
AA seq 114 aa
MDVFEGISLANWVCLAKWESSYNIRATNYDPGDKSTDYGIFQINSRYWCNDGKAPRAVNA
CGISCNILLQDAITQAIAYAKRVVSDPQGIRAWVAWRNHHRNHNLTQYIQGCGV
NT seq 345 nt   +upstreamnt  +downstreamnt
atggatgtcttcgagggaatcagcctggcaaactgggtgtgtttggccaaatgggagagt
agttacaacatccgagctacaaactacgatcctggagacaaaagcactgattatgggatt
tttcagatcaacagccgctactggtgtaatgatggtaaagccccaagagcagttaatgca
tgtggcatatcttgcaatattttgctgcaagatgctatcactcaagctatagcttatgca
aagagggttgtcagtgatccgcaaggcattagagcatgggtggcatggagaaaccatcat
cggaaccacaatctcactcagtacattcaaggttgtggagtttaa

KEGG   Loxodonta africana (African savanna elephant): 100667364
Entry
100667364         CDS       T04351                                 

Definition
(RefSeq) lysozyme C, spleen isozyme-like
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100667364
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100667364
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100667364
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100667364
SSDB
Motif
Pfam: Lys SLT SLT_3
Other DBs
NCBI-GeneID: 100667364
NCBI-ProteinID: XP_003405248
UniProt: G3SXQ8
LinkDB
Position
Unknown
AA seq 148 aa
MRALLILGLLFLSGTVHGKVFERCELARTLKRHGLGGYRGISLANWVCLAKHESNYNTRA
TNYNPPDKSTDYGIFQINSRYWCNDGKTPRAVNACGISCKALLQDDITQAIACAKRVVRD
PQGIKAWVAWRNHCQNHDLTQYVRGCGV
NT seq 447 nt   +upstreamnt  +downstreamnt
atgagggctctccttattctggggcttctcttcctttctggcactgtccatggcaaggtc
tttgaaaggtgcgagttggcccgaactctgaagcgacatggactgggtggctacagagga
atcagcctggcaaactgggtgtgtttggccaaacatgagagtaattacaacacccgagcc
acaaactataatcctccagacaaaagcactgattatgggatttttcagatcaatagccgc
tactggtgtaatgatggcaaaaccccaagagcagttaatgcctgtggcatatcttgcaaa
gctttgctgcaagatgatatcactcaagctatagcttgtgcgaagagagtcgtcagggat
ccacaaggcattaaagcatgggtggcgtggagaaaccattgtcagaaccacgatctcact
cagtacgttcgaggctgtggggtttaa

DBGET integrated database retrieval system