KEGG   Loxodonta africana (African savanna elephant): 100666578
Entry
100666578         CDS       T04351                                 

Gene name
GRK3
Definition
(RefSeq) beta-adrenergic receptor kinase 2 isoform X1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04062  Chemokine signaling pathway
lav04144  Endocytosis
lav04340  Hedgehog signaling pathway
lav04724  Glutamatergic synapse
lav04740  Olfactory transduction
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100666578 (GRK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100666578 (GRK3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100666578 (GRK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100666578 (GRK3)
  09157 Sensory system
   04740 Olfactory transduction
    100666578 (GRK3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100666578 (GRK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100666578 (GRK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100666578 (GRK3)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     100666578 (GRK3)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   100666578 (GRK3)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100666578 (GRK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal HTH_WhiA
Other DBs
NCBI-GeneID: 100666578
NCBI-ProteinID: XP_003419144
UniProt: G3TDB9
LinkDB
Position
Unknown
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKATPAARASKKIVLPEPSIRSVMQKYLEERKEITFDKIFN
QKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDHEEDRLCRSRQIYDTYIMKELLSC
SHPFSKQAVEHVQTHLVKKQVPPTLFQPYIEEICESLRGNIFQKFMESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPE
LTSLLEALLQRDVSKRLGCHGGGAQEVKEHCFFQGIDWQHVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVAETVYDAVNADTDKIEARK
RAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQIVSVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTETFKEAQRLLRR
APKFLNKPRSTVVELSKPPLCHRNSNGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctggaggccgtgctggccgatgtcagctacctgatggcgatggagaagagc
aaggcgacgccggccgcccgcgccagcaagaagatcgtcctgccggagcccagtatccgg
agtgtgatgcagaagtatcttgaggagagaaaggaaataacctttgacaagattttcaat
cagaaaattggtttcttgctatttaaagatttttgtttgaatgaaattaatgaagctgta
cctcaggtgaagttttatgaagagataaaagaatatgaaaagcttgaccacgaggaagat
cgtctttgtagaagtcgacaaatttatgacacctatatcatgaaggaactcctctcttgt
tcgcatccattctcaaagcaagctgtagaacatgtacaaactcacctagtcaagaagcaa
gtgccaccaactctttttcagccatatatagaagaaatctgtgaaagtcttcgaggcaac
atttttcaaaaatttatggaaagtgacaagttcactagattttgtcagtggaaaaacgtg
gaactaaatatccatttgaccatgaatgatttcagtgtacatagaattattggacgagga
ggatttggtgaagtgtatggatgcaggaaagcagacactggaaaaatgtatgccatgaaa
tgcttagataagaagaggatcaagatgaaacaaggagaaacattagccttaaatgaaagg
atcatgttatctcttgtcagtacaggagattgccctttcattgtctgtatgacctatgcc
ttccacaccccagataaactctgcttcatcctggatctgatgaatggaggtgatctgcac
tatcacctttcacagcacggggtgttttctgagaaggagatgcggttttatgccactgaa
atcatcctagggctggagcacatgcacaatcggttcgttgtttacagagatttaaagcct
gcaaatatcctcctggatgaacacggccatgtaaggatatcagatctcggtcttgcctgt
gatttttccaagaagaagccgcatgcgagtgttggcacccacgggtacatggctcctgag
gtgctgcagaagggcacggcatacgacagcagtgctgactggttctccctgggctgcatg
ctcttcaagcttctgagaggccacagccctttcagacaacataaaaccaaagataaacat
gaaatagaccgaatgacactcaccgtgaatgtggaacttccagatacgttctcccccgaa
ttaacgtcccttttggaagccttacttcagcgagacgttagcaaacgacttggctgtcat
ggaggcggtgcacaggaagtaaaagagcattgctttttccaaggcattgactggcagcat
gtctacttacaaaagtaccctccacccttgattcctccccgcggagaagtcaatgccgct
gacgcctttgatatcggctcatttgatgaagaggacaccaaaggcattaagcttctcgac
tgcgaccaagaactctacaagaacttccctttggtaatctcggaacgctggcagcaggaa
gtggcggaaactgtgtatgatgcagtcaatgcagacacggataaaatcgaggccaggaag
agggctaaaaataagcagcttggccatgaagaagattacgcgctgggaaaggactgtatt
atgcatggctacatgttaaaactggggaacccatttctgactcagtggcagcggcgatac
ttctaccttttcccaaatagactcgagtggagaggggagggcgagtctcggcaaaatttg
ctgactatggaacagattgtatctgtggaagaaactcagattaaagacaagaaatgcatt
ttgctaaggataaaaggagggaagcagtttgttttgcagtgtgagagtgatccagagttt
gtacagtggaaaaaggagttgaccgaaacctttaaggaagcccagaggttactgcgccga
gctccaaagttcctcaacaagcctcgatccactgtggtggagctctcgaagccacccctg
tgtcacagaaacagcaatggcctttaa

KEGG   Loxodonta africana (African savanna elephant): 100671884
Entry
100671884         CDS       T04351                                 

Gene name
GRK2
Definition
(RefSeq) beta-adrenergic receptor kinase 1 isoform X1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04062  Chemokine signaling pathway
lav04144  Endocytosis
lav04340  Hedgehog signaling pathway
lav04724  Glutamatergic synapse
lav04740  Olfactory transduction
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100671884 (GRK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100671884 (GRK2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100671884 (GRK2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100671884 (GRK2)
  09157 Sensory system
   04740 Olfactory transduction
    100671884 (GRK2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100671884 (GRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100671884 (GRK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100671884 (GRK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     100671884 (GRK2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   100671884 (GRK2)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100671884 (GRK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100671884
NCBI-ProteinID: XP_023415317
LinkDB
Position
Unknown
AA seq 728 aa
MDGLHCVYPFTSGPGFGDLAKFPKLARGSARTRLLWVVGFRGPGPDPGCSGQDVDGRYQL
SGCHCVPCLPGGSGDPAGPSSLQLQSLGKVSAASQGEDCSCARHRDSWAPFTLSLSGSIR
SVMQKYLEDRGEVAFEKIFSQKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLETEEE
RLARSREIFDVYIMKELLACSHPFSKSATEHVQGHLVKKQVPPDLFQPYIEEICQNLRGD
VFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMK
CLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLH
YHLSQHGVFSEADMRFYAAEIILGLEHMHNCFVVYRDLKPANILLDEHGHVRISDLGLAC
DFSKKKPHASVGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKH
EIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQM
VFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQE
VAETVFDTINVETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRY
FYLFPNRLEWRGEGEAPVRSGEPRGGGGEVPGTGGVWGRGPGDVGHGDSGEPGMVGPGDR
AAKGQGSW
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggatgggctacactgtgtttatccattcaccagtgggcctggctttggggatttggcc
aagttcccaaagctggcacgtggcagtgctaggactagacttctgtgggtggtgggcttc
cggggacctgggcccgatcctggctgctctgggcaggacgttgatggcaggtatcagctc
tctgggtgccactgtgtgccctgccttcctggagggagcggtgacccagcaggcccctcc
agccttcagctccagtccctgggcaaggtgtcagcggccagccaaggagaggactgcagc
tgtgccaggcatagggactcctgggctccattcaccttgtccctctctggcagcatccgc
agcgtcatgcagaagtacctagaggaccggggcgaggtggcctttgagaagatcttctcc
cagaagctggggtacctgctcttccgagacttctgcctgaaccacttagaggaggccagg
cccctggtggagttctatgaggagatcaagaaatacgagaagctggagaccgaggaggag
cgcctggctcggagccgggagatctttgatgtctacatcatgaaggagctgctggcctgt
tcgcaccccttctcgaaaagtgccactgagcacgtccagggccacctggtgaagaagcag
gtgcctccagacctcttccagccctatattgaagagatctgtcagaatctccgtggggat
gtgttccaaaagttcattgagagcgataaattcacacggttttgtcagtggaagaacgtg
gagctcaacatccatctaaccatgaacgacttcagtgtccatcgcattatcgggcgcggc
ggctttggcgaggtctatgggtgccgcaaggctgacacgggcaagatgtatgccatgaag
tgtctggacaagaagcgcatcaagatgaaacagggggagacactggccctgaacgagcgt
atcatgctgtccctcgtcagcaccggggactgtcccttcatcgtctgcatgtcgtacgca
ttccacacgcctgacaaactcagcttcatccttgacctcatgaacggtggggacctgcac
taccacctgtcccagcatggggtcttctctgaggccgacatgcgcttctacgcggccgag
atcatcctgggcctggagcacatgcacaactgcttcgtcgtttaccgggacctgaagcca
gccaacatcctcctggacgaacatggccacgtgcgcatctcggacctgggcctggcctgt
gacttctccaagaagaagccccacgccagcgtgggcacccacgggtacatggcccccgag
gtcctgcagaagggcgtggcctacgatagcagtgccgactggttctctctgggctgcatg
ctcttcaagctgctccgggggcacagccccttccggcaacacaagaccaaagacaagcac
gagatcgatcggatgacgttgacaatggctgtggagctgcctgactccttttcccccgaa
ctccgctccttgctggaggggctgcttcagcgggatgtcaaccggagactgggctgcctg
ggccgaggggctcaggaggtgaaggagagccccttcttccgctccttggactggcagatg
gtcttcctgcagaagtacccacccccgctgatccccccacggggggaggtgaacgcggcc
gacgccttcgacattggctcctttgatgaagaggacacaaaggggatcaagttactggac
agtgaccaggagctctaccgcaacttccccctcaccatctcggagcggtggcagcaggag
gtggcggagaccgtgtttgacaccatcaatgtggagacagaccggctggaggcccgcaag
aaagctaaaaacaagcagctgggccacgaggaggattacgccctgggcaaggattgcatc
atgcatggctacatgtctaagatgggcaaccccttcctgacccagtggcagcggcggtac
ttctacctattccccaaccggctggagtggcggggcgagggcgaggccccagtaaggagt
ggggagcccaggggcggggggggggaagtacctggtacagggggagtttggggacgggga
cctggggacgtggggcatggggacagtggggagcctgggatggtggggcctggagatagg
gcagccaagggtcagggcagctggtag

DBGET integrated database retrieval system