KEGG   Loxodonta africana (African savanna elephant): 100666628Help
Entry
100666628         CDS       T04351                                 

Gene name
MAGI2
Definition
(RefSeq) LOW QUALITY PROTEIN: membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
  KO
K05629  atrophin-1 interacting protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100666628 (MAGI2)
   04151 PI3K-Akt signaling pathway
    100666628 (MAGI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 MAGI_u1 PDZ_2 WW Guanylate_kin MAGI_u5
Motif
Other DBs
NCBI-GeneID: 100666628
NCBI-ProteinID: XP_003407228
LinkDB All DBs
Position
Unknown
AA seq 1446 aa AA seqDB search
MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKL
VSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERP
VVNGNGVVITPESSENEDKSTGASGETPSQPYPAPVYSQPEELKEQMDDTKATKPEENDD
SDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDP
IYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVC
VLGHTHADVVKLFQSVPIGQSVNLVLCDTPLLLILRSANSMVPPLAIMERQPPVMVNGRY
NYETYLEYISRTSQSVPDITDRPPHSLHSMPADGQLDGTYPPPVHDDNVSMASSGATQAE
LMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEV
VDILKDCPLGSETSLVIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFPPA
LHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVHLR
RMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVI
DLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAVPS
SNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSP
ADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPSSE
KQSPMAQQHSPLAQQSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKP
DIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPVSDYRQPQ
DFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGES
TRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPTSWSSPAAASPDLPEVGVSLEDV
LSPFSPSHPALPSDPSHQISPDPSWDIKREHDVRKPKELSAGGQKKQRLGEQSERSASPQ
RAARPRLEEAPGGQGRPEAGSPALGERGERGASRREGKASAQRPAPSSGRRDGPGAAFAF
AGPXGGGGGAREVEGRAGARAGPRQGARPPGGAPARKATVAPGPWKVPGSDKLPGVLKPG
TSTASR
NT seq 4341 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaagcctgaaaaagaaaagccactggactagcaaagtccatgagagtgtcatt
ggcaggaacccggagggtcagctgggctttgaactgaaggggggcgccgagaatggacaa
ttcccctacctgggggaggtgaagcccggcaaggtggcctatgagagcggcagtaagttg
gtatcggaggagctgctgctggaggtgaacgagacccctgtggctgggctcaccatcagg
gacgtgctggccgtcatcaaacactgcaaggaccccctccggctcaaatgtgtcaagcaa
ggaggcattgttgataaggatcttcgtcactacctcaacttacggtttcagaagggttct
gtggaccacgaacttcagcaaatcatccgtgataacctctacctccgcacggtgccatgc
accacaaggccacataaggagggcgaggtccctggagtggactatattttcatcactgtt
gaagattttatggaattggagaaaagtggtgctctcctcgaaagtgggacctatgaagac
aattactatgggacgccaaagcctccagcagaaccagcaccattattgttaaatgtaaca
gaccagatacttccaggagccactccaagtgctgaaggaaagcggaagaggaataaatca
gtgagcaacatggagaaagcaagtatagagcctcccgaggaggaggaggaagagaggcct
gtggtcaacggaaatggagtcgtaataacgccagaatccagtgaaaatgaagacaagagt
acaggtgcctcaggggagacaccctcccagccttatcctgcaccggtgtacagtcaacct
gaggagctaaaggagcagatggatgacacaaaggcaactaaacctgaagaaaatgatgac
tcagaccccttgcctgataactgggaaatggcctatacagaaaagggtgaagtctacttc
attgaccataacacaaagacaacatcatggctggatccacgacttgcgaaaaaggctaaa
cctccagaagagtgcaaagaaaatgagcttccgtatggctgggaaaaaatcgatgatccc
atatatggcacttattatgttgaccacataaatagaagaacacagtttgaaaaccccgtc
ctggaagcaaaaaggaagctacaacagcataacatgccccacacagaacttggaacaaag
cccctgcaggccccaggtttccgagaaaaaccactgttcacccgggatgcatcccagttg
aagggaacattcctcagcaccaccctaaaaaagagcaacatgggttttggatttaccatc
attggcggagatgagcctgatgagtttctacaggtgaaaagtgtgattccagatggaccg
gcagcacaggatggaaagatggaaacaggtgatgtcattgtctatattaatgaagtttgt
gtccttggacacactcatgcagatgtagtcaaacttttccagtctgttcctattggccag
agtgtcaacctggtgttgtgtgatactcccttgctcttgatcctgagatctgctaacagc
atggtgccaccccttgcaataatggagaggcaacctccagtgatggtcaatggaaggtat
aactatgaaacatatttagaatacatttctagaacctcacagtctgttccagatataaca
gatcggccacctcattctttgcattccatgccagctgatggccaactagatggcacgtat
ccaccacctgtccatgatgacaatgtgtctatggcttcctctggggccacccaagctgaa
cttatgaccttaaccattgtgaaaggtgcccagggctttggcttcactattgctgacagt
cctacaggacagcgggtgaaacaaatacttgacattcagggatgccctggcctctgtgaa
ggtgacctcatcgttgagatcaaccagcagaatgtacagaacctgagccatacagaagta
gtggatatacttaaggactgtccccttggaagtgagacttctttggtcatccatcgagga
ggtttcttttctccatggaaaactccaaagcctataatggaccgatgggagaatcaaggc
agtcctcaaacaagtttatctgctccggccataccgcagaacctgcccttcccacctgcc
cttcacagaagctcgtttcctgactcaacagaggcctttgacccaaggaagcctgaccca
tatgagctctacgagaaatctagagccatttatgaaagtaggcaacaagtgccacccagg
accagttttcgaatggattcctctggtccagattataaggagttggatgttcaccttcgg
aggatggagtctggatttggcttcagaatcctcgggggagatgagcctggacaacctatt
ttgattggagccgtaattgccatgggctctgccgacagagatggccgcctacacccaggc
gatgagctcgtctatgtcgatgggattcctgtggctggcaagacccaccgctatgtcatc
gacctgatgcaccacgcagcccggaacggacaggtcaacctcactgtgagaagaaaggtg
ctatgtggaggggagccttgcccagagaatgggaggagtccgggttctgtgtcaacccac
cacagctctccacgcagtgactacgcaacctacaccaacagcaaccacgctgtccccagc
agcaatgcctctccccctgagggcttcgcctctcacagcctacagaccagcgatgtggtc
attcaccgcaaagagaatgaaggcttcggctttgtcatcatcagctccctgaacaggcct
gagtccggatccacaataactgtgccccataaaatcggacgcatcattgatggcagtcct
gccgatcgctgtgccaaactaaaggtgggagaccggatattagcggtgaacggccagtct
atcatcaacatgcctcatgcagacatcgtgaagctcatcaaggacgcaggccttagtgtc
acccttcgcatcattccccaggaggagctcaacagccccacctcggcgcccagctccgag
aagcagagccccatggcccagcagcacagccccttggcccagcagagtcctctggcccag
ccgagcccagccacccccaacagccctgtcgcccaaccagctcctcctcagccgcttcaa
ctgcaaggacatgaaaatagttacaggtcagaagtaaaagccagacaagatgtgaaacca
gacatccgacagcctccattcacggattacaggcagcccccactggactacaggcagccc
cctggaggggactatcagcagcccccacccttggactacaggcagcctccactgctggac
tacaggcagcactcccctgacaccaggcagtaccctgtgtcagactacaggcagccccag
gattttgattatttcactgtggacatggagaaaggagccaaagggtttggattcagcatc
cgtggaggaagggaatacaaaatggatttgtacgtgttgagactggcagaagacgggcca
gcaataaggaatggaagaatgagggtaggagatcaaatcattgaaatcaatggggaaagc
acaagggacatgacacatgccagagcaatagagctcatcaaatctggaggaagaagagtg
aggctactgctaaagcgcggaacaggacaggtcccagagtatgacgaacccacctcctgg
agttctcccgctgcagcctccccagatctgccggaagtaggcgtctccctcgaagacgtc
ctctcgccattctctccatcacatccagccctaccctccgacccttcccaccagataagc
ccagacccatcttgggatatcaaaagggaacacgacgttaggaaaccaaaggagctttca
gccggcggccagaagaagcagcgcctcggggagcagagcgagcgctcggccagtccgcag
agggccgcgcggccgaggctcgaggaggcgcctggcggccaggggcggcccgaggccggc
agccccgccctcggagaacgcggcgaacgcggcgcgtcccggcgggaagggaaggcgtcc
gcgcagcgcccggccccgagctcgggccggcgcgacggcccgggtgctgcgttcgcgttc
gcgggcccannaggcggcggcggtggcgcgcgggaggtcgagggaagggcgggcgcgcgc
gcgggccctcggcagggcgcgcggcctccagggggcgccccggcgcgcaaggccaccgtc
gcgccggggccgtggaaggtgcccggctccgacaagctgccgggagtcctcaaacccggc
acctccaccgccagcagatga

DBGET integrated database retrieval system