KEGG   Loxodonta africana (African savanna elephant): 100666671Help
Entry
100666671         CDS       T04351                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00250  Alanine, aspartate and glutamate metabolism
lav00280  Valine, leucine and isoleucine degradation
lav00410  beta-Alanine metabolism
lav00640  Propanoate metabolism
lav00650  Butanoate metabolism
lav01100  Metabolic pathways
lav04727  GABAergic synapse
Module
lav_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100666671 (ABAT)
   00650 Butanoate metabolism
    100666671 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100666671 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    100666671 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100666671 (ABAT)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100666671 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lav01007]
    100666671 (ABAT)
Enzymes [BR:lav01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100666671 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100666671 (ABAT)
Amino acid related enzymes [BR:lav01007]
 Aminotransferase (transaminase)
  Class III
   100666671 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Tex_N
Motif
Other DBs
NCBI-GeneID: 100666671
NCBI-ProteinID: XP_023413049
LinkDB All DBs
Position
Unknown
AA seq 575 aa AA seqDB search
MASRLLTRQLASSLQHNYRLLMPACLFAYNFPDTGVSRFLNFPCPWGAQAQSRCSVGSLA
GVGLRSWLHLCWGHWTSFGAESSLYLCDQGFLLSLFPAGSRHIGQASAKVDMEFDYDGPL
MKTEVPGPRSRELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQIASVPI
GYSHPALMKLLQQPQNVNTFVNRPALGILPPGDFVEKLRESLLSVAPKGMSQIITMACGS
CSNENAFKTIFMWYRNKERGHTEFSKEELETCMINQAPGCPDYSILSFMGAFHGRTLGCL
ATTHSKAIHKIDIPSFDWPIAPFPWLKYPLEDFVKENQQEEARCLEEVEDLIVKYRKKKK
TVAGIIVEPIQSEGGDNHASDDFFWKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWG
LDDPADLMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINVIKREDLL
NNAAHAGKTLLTGLLELQARYPQFISRARGRGTFCSFDTPDESIRNKLILIARNKGVVLG
GCGNKSIRFRPTMVFRDHHAHLFLNIFSDILANFK
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaggctgcttacccggcagctggcctccagcctccagcacaactaccgcctg
cttatgcccgcttgcctgtttgcctacaacttccctgacactggggtttcccggtttttg
aactttccttgtccgtggggcgcccaggcccagagccggtgctctgtggggagcctggct
ggggtggggttgaggtcctggctccacctctgctggggacactggacatcttttggggca
gaatcctcattatatctatgtgaccaggggtttttactgtctttgtttcctgcagggtcc
agacatatcggtcaggcctcagccaaagtcgatatggagtttgattacgatgggcctctg
atgaagacggaagtcccggggcctcggtctcgggagttaatgaaacagctgaatataatt
cagaatgcagaggctgtgcattttttctgcaactatgaagagagccgaggcaactacctg
gtcgacgtggatggcaatcggatgttggatctttactcacagatcgcctctgtccccata
ggttacagccaccctgctctcatgaaactcctccagcagcctcaaaatgtgaacactttc
gtcaacaggcctgctctcggcatcctgcctccaggggacttcgtggagaaactcagggag
tccttgctctcggtggctcccaaagggatgtcccagatcatcaccatggcctgcggctcc
tgctccaatgagaacgccttcaagaccatcttcatgtggtaccggaacaaggaaaggggt
catacagagttctccaaagaggagctggagacctgcatgatcaaccaggcccccgggtgt
cccgactacagcatcctctccttcatgggcgcattccatgggaggaccttgggttgctta
gcgaccacgcactccaaagctattcacaagattgacatcccttccttcgactggcccatt
gcaccattcccatggctaaaataccctctggaagacttcgtgaaagagaaccaacaggaa
gaggcccgctgcctggaagaggtggaggatctgattgtgaaatatcggaaaaagaagaag
acagtggctgggatcattgtggagcccatccagtctgagggtggggacaaccacgcctcc
gatgacttcttctggaagctgagagacatcgccaggaaacatggctgtgcgttcctggtg
gatgaggtccagacgggagggggctgcaccggtaagttctgggcccacgagcactggggc
ttggatgacccagctgacctgatgaccttcagcaagaagatgatgaccgggggcttcttc
cacaaggaggagttccggcccaatgctccttaccggatcttcaacacctggctgggggac
ccgtccaagaacctgctgctggccgaggtcatcaacgtcatcaagcgggaggacctgctg
aataacgcagcccatgccgggaagaccctgctcacggggctgctggagctccaggcccgg
tacccccagttcatcagccgagcgagaggacgaggcaccttctgctccttcgacactcca
gatgaatccatacggaataaactcattttaatagccagaaacaaaggtgtggtgttgggg
ggctgtggcaacaaatccatccgtttccgtcctaccatggtcttcagggatcaccatgcg
cacctgttcctcaatattttcagcgacatcttagccaacttcaagtaa

DBGET integrated database retrieval system