KEGG   Loxodonta africana (African savanna elephant): 100666679
Entry
100666679         CDS       T04351                                 

Definition
(RefSeq) HRAS-like suppressor 3 isoform X1
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100666679
   00565 Ether lipid metabolism
    100666679
   00590 Arachidonic acid metabolism
    100666679
   00591 Linoleic acid metabolism
    100666679
   00592 alpha-Linolenic acid metabolism
    100666679
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100666679
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100666679
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100666679
    3.1.1.32  phospholipase A1
     100666679
SSDB
Motif
Pfam: LRAT Calici_PP_N Peptidase_C97 Churchill
Other DBs
NCBI-GeneID: 100666679
NCBI-ProteinID: XP_003419505
LinkDB
Position
Unknown
AA seq 162 aa
MRSLIPEPQPGDLIEIFRPLYRHWAIYVGDGYVVHLAPPSEIAGAGAASVMSALTDKAIV
KKELLYDVAGRDKYQVNNKHDNKYPPLPPSKIIQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVARSDQVRDVVMAAGIAGLGLAAMALIGIMFSRNKRQKQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcgctcgctcattccagagccccagcctggagacctgattgagattttccgccctctc
tacagacactgggccatctacgttggcgatggatatgtggtccacctggctcccccaagt
gaaatcgctggagctggtgcggccagtgtcatgtctgccctgacggataaggccatagtg
aagaaggaactgctatatgatgtggccgggcgggacaagtaccaggtcaataacaagcat
gataacaagtacccgcccctacctcccagcaaaatcatccagcgggcggaggagctggtg
ggacaggaggtactttacaagctgaccagcgagaactgcgagcactttgtgaacgagctg
cgctatggagtcgcccgcagtgaccaggtcagagatgttgtcatggcagcaggcattgca
ggattgggcttggcagccatggccctcattggaatcatgttctcaagaaataagcggcaa
aagcaataa

KEGG   Loxodonta africana (African savanna elephant): 100667251
Entry
100667251         CDS       T04351                                 

Definition
(RefSeq) HRAS-like suppressor 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100667251
   00565 Ether lipid metabolism
    100667251
   00590 Arachidonic acid metabolism
    100667251
   00591 Linoleic acid metabolism
    100667251
   00592 alpha-Linolenic acid metabolism
    100667251
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100667251
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100667251
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100667251
    3.1.1.32  phospholipase A1
     100667251
SSDB
Motif
Pfam: LRAT Calici_PP_N Peptidase_C97 NLPC_P60
Other DBs
NCBI-GeneID: 100667251
NCBI-ProteinID: XP_010597482
LinkDB
Position
Unknown
AA seq 151 aa
MDRPNLGDLIEIFRIGYQHWAIYVGDGYVIHLAPPSEIAGAGSASLMSAVVDRAVVKKEL
LSVVVGQDRYRLNNKHDNKYPPLPPRNIVWQAEELVGQEVLYQLTSRNCEHFVNKLRYGV
ACSDQVSDAISVVGAVGVCLAAIGLTVLLVI
NT seq 456 nt   +upstreamnt  +downstreamnt
atggacagaccaaatcttggagacctgattgagatttttcgcattggctaccagcactgg
gccatctacgtgggagatggttatgtgatccacctggctcctccaagtgaaatcgctgga
gctggttcagccagtctcatgtcagccgtggtggatagagctgtagtgaagaaggaactg
ctgtctgtggtggttggacaggacaggtaccggctcaataacaagcatgataacaagtac
ccgcccctacctcccagaaatatcgtctggcaggcggaggagctggtgggacaggaggtg
ctctaccagctgaccagcaggaactgcgagcactttgtgaacaagctgcgctatggagtc
gcctgcagtgaccaggtctctgatgccatctctgtagtgggcgccgtgggagtgtgcctg
gcagccataggcctcactgtgcttctggtgatctga

DBGET integrated database retrieval system