KEGG   Loxodonta africana (African savanna elephant): 100666748
Entry
100666748         CDS       T04351                                 

Gene name
FSHB
Definition
(RefSeq) follitropin subunit beta
  KO
K05250  follitropin subunit beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100666748 (FSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100666748 (FSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100666748 (FSHB)
   04913 Ovarian steroidogenesis
    100666748 (FSHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 100666748
NCBI-ProteinID: XP_003412354
UniProt: A0A0F7RPW5
LinkDB
Position
Unknown
AA seq 129 aa
MKSIQFYFLFCCWKAMCCSSCELTNVTIAVEKEECRFCISINTTWCAGYCYTRDLVYKDP
ARPNTQKTCTFKELVYETVRVPGCAHHADSLYTYPVATECHCGKCDSDSTDCTVRGLGPS
YCSFSEMKE
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaagtcaatccagttttacttccttttctgttgctggaaagcaatgtgctgcagtagc
tgtgagttgaccaatgtcaccatcgcagtggagaaagaggagtgccgcttctgcataagc
atcaataccacttggtgtgcaggctactgctacactcgggacttggtatataaggaccca
gcccggcccaacacccagaagacatgtaccttcaaggagctggtgtatgagacagtaaga
gtgcccggctgtgctcaccatgcagactccctgtatacgtacccagtggccactgaatgt
cactgtggcaagtgtgacagcgacagcactgactgcactgtgcgaggcctggggcccagc
tactgctccttcagtgaaatgaaagaataa

DBGET integrated database retrieval system