KEGG   Loxodonta africana (African savanna elephant): 100666827
Entry
100666827         CDS       T04351                                 

Gene name
CCKAR
Definition
(RefSeq) cholecystokinin receptor type A
  KO
K04194  cholecystokinin A receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04911  Insulin secretion
lav04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100666827 (CCKAR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100666827 (CCKAR)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100666827 (CCKAR)
  09154 Digestive system
   04972 Pancreatic secretion
    100666827 (CCKAR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100666827 (CCKAR)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    100666827 (CCKAR)
SSDB
Motif
Pfam: 7tm_1 CholecysA-Rec_N 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100666827
NCBI-ProteinID: XP_003411430
LinkDB
Position
Unknown
AA seq 428 aa
MDVVDSFLVNGSNITPPCELGLENETLFCLDQPHSSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDAMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFDASQKKSAKERKLSTGSSGRYEDSDGCYLQKSKHPRKLELQQLSTCSSGRVSRIRSSS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANTWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPAGVRGDVGEEEEGRTTGASLSRYSYSH
VSASAPPP
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggatgtggttgacagctttcttgtgaatggaagcaacatcacccctccctgtgaactc
ggacttgaaaatgaaacccttttctgcctggatcagccccattcttccaaagagtggcag
ccggcggtgcagattctcttgtattccttgatattcctgctcagcgtgctgggaaacaca
ctggtcatcacggtgctgattcggaacaagaggatgaggacagtcaccaacatcttcctg
ctctccctggctgtcagcgacctcatgctttgcctcttctgcatgccgtttaacctcatc
cccaaccttctcaaggatttcatcttcggcagcgctgtttgcaagaccaccacctacttc
atgggcacctctgtgagtgtatccacctttaatctggtcgccatatctctggagagatac
ggtgcgatttgcaaacccttgcagtcccgggtctggcagacaaagtcccatgccttgaag
gtgattgccgctacctggtgtctctcctttaccatcatgactccgtacccaatttatagc
aacttggtgccttttaccaaaaataacaaccagacagcgaacatgtgccgctttctgcta
ccaaatgatgctatgcagcagtcctggcacacattcctgttactcatcctctttcttatt
cctggaattgtgatgatggtggcgtatggattaatctctttggaactctaccaaggtata
aaatttgatgctagccagaagaaatccgctaaagaaaggaagctcagcaccggcagcagt
ggcagatacgaagatagcgacgggtgttacctgcagaagtccaagcaccccaggaagctg
gagctgcagcagctgtccacctgcagcagcggcagggtcagccgcatcaggagcagcagc
tccgcagccaacctgatggccaagaagcgggtgatccgcatgctcatcgtcatcgtggtc
ctctttttcctgtgctggatgcccatcttcagcgccaacacctggcgggcgtatgacaca
gcttctgccgagcgccgcctctcggggacccccatttccttcatcctcctgctctcctac
acgtcttcttgtgtcaaccccatcatctactgcttcatgaacaaaaggttccgcctcggc
ttcatggccaccttcccctgctgccccaaccctggtcccgcaggagtgagaggagacgtg
ggggaggaggaggaaggtaggaccacgggggcctctctgtccaggtactcgtacagtcac
gtgagtgcttctgccccgcccccctga

DBGET integrated database retrieval system