KEGG   Loxodonta africana (African savanna elephant): 100666845Help
Entry
100666845         CDS       T04351                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1 isoform X2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04213  Longevity regulating pathway - multiple species
lav04330  Notch signaling pathway
lav04919  Thyroid hormone signaling pathway
lav05016  Huntington's disease
lav05034  Alcoholism
lav05165  Human papillomavirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:lav00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100666845 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100666845 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100666845 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    100666845 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100666845 (HDAC1)
   05202 Transcriptional misregulation in cancers
    100666845 (HDAC1)
   05203 Viral carcinogenesis
    100666845 (HDAC1)
   05220 Chronic myeloid leukemia
    100666845 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    100666845 (HDAC1)
  Substance dependence
   05034 Alcoholism
    100666845 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100666845 (HDAC1)
   05165 Human papillomavirus infection
    100666845 (HDAC1)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100666845 (HDAC1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100666845 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     100666845 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100666845 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    100666845 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100666845
NCBI-ProteinID: XP_003415511
UniProt: G3SV40
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FRPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHSKCVEFVRNFNLPMLMLGG
GGYTIRNVARCWTYETAVALSTDIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggtcacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctgctcaactatggtctctaccgaaagatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgatgactacattaaattcttgcgctccatccgc
ccagacaacatgtctgagtacagtaagcagatgcagagattcaacgttggtgaggactgt
ccagtatttgatggcctgtttgagttctgtcagttgtctgctggtggatctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccatggt
gatggagtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaacaggggacttacgggatattggcgctggcaaaggcaag
tattatgccgttaactacccgctccgagatgggattgatgatgagtcctatgaggccatt
ttcaggccggtcatatccaaagtaatggagatgttccagcctagtgcagtcgtcttacag
tgtggctctgactccctctctggggatcgattaggttgtttcaatctgaccatcaaaggg
cattccaagtgtgtggaatttgtgaggaatttcaaccttccgatgctgatgctgggagga
ggtggctacaccattcgtaatgtcgccaggtgttggacgtatgaaacagctgtggccctg
agcacagatatccctaacgagcttccatacaatgactactttgaatactttggaccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaacactaatgagtacttggag
aagatcaaacagagactatttgagaacctgagaatgttgccccacgcacctggggttcaa
atgcaggcgattcctgaggatgccattccagaggaaagcggtgatgaggatgaagaggac
cctgacaaacgcatctcgatctgttcctctgacaaacgaattgcttgtgaagaagagttc
tctgactccgatgaggagggagagggtggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagacccagaagagaagaaagaagtcaca
gaagaagagaaaaccaaggaggagaagccggaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system