KEGG   Loxodonta africana (African savanna elephant): 100666845
Entry
100666845         CDS       T04351                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1 isoform X2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04213  Longevity regulating pathway - multiple species
lav04330  Notch signaling pathway
lav04613  Neutrophil extracellular trap formation
lav04919  Thyroid hormone signaling pathway
lav05016  Huntington disease
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05165  Human papillomavirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05206  MicroRNAs in cancer
lav05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100666845 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100666845 (HDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100666845 (HDAC1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100666845 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100666845 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100666845 (HDAC1)
   05202 Transcriptional misregulation in cancer
    100666845 (HDAC1)
   05206 MicroRNAs in cancer
    100666845 (HDAC1)
   05203 Viral carcinogenesis
    100666845 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100666845 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100666845 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100666845 (HDAC1)
   05034 Alcoholism
    100666845 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100666845 (HDAC1)
   05165 Human papillomavirus infection
    100666845 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100666845 (HDAC1)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100666845 (HDAC1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100666845 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     100666845 (HDAC1)
    BRAF-HDAC complex
     100666845 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100666845 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    100666845 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 100666845
NCBI-ProteinID: XP_003415511
UniProt: G3SV40
LinkDB
Position
Unknown
AA seq 482 aa
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FRPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHSKCVEFVRNFNLPMLMLGG
GGYTIRNVARCWTYETAVALSTDIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggtcacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctgctcaactatggtctctaccgaaagatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgatgactacattaaattcttgcgctccatccgc
ccagacaacatgtctgagtacagtaagcagatgcagagattcaacgttggtgaggactgt
ccagtatttgatggcctgtttgagttctgtcagttgtctgctggtggatctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccatggt
gatggagtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaacaggggacttacgggatattggcgctggcaaaggcaag
tattatgccgttaactacccgctccgagatgggattgatgatgagtcctatgaggccatt
ttcaggccggtcatatccaaagtaatggagatgttccagcctagtgcagtcgtcttacag
tgtggctctgactccctctctggggatcgattaggttgtttcaatctgaccatcaaaggg
cattccaagtgtgtggaatttgtgaggaatttcaaccttccgatgctgatgctgggagga
ggtggctacaccattcgtaatgtcgccaggtgttggacgtatgaaacagctgtggccctg
agcacagatatccctaacgagcttccatacaatgactactttgaatactttggaccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaacactaatgagtacttggag
aagatcaaacagagactatttgagaacctgagaatgttgccccacgcacctggggttcaa
atgcaggcgattcctgaggatgccattccagaggaaagcggtgatgaggatgaagaggac
cctgacaaacgcatctcgatctgttcctctgacaaacgaattgcttgtgaagaagagttc
tctgactccgatgaggagggagagggtggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagacccagaagagaagaaagaagtcaca
gaagaagagaaaaccaaggaggagaagccggaagccaaaggggtcaaggaggaggtcaag
ttggcctga

KEGG   Loxodonta africana (African savanna elephant): 100673540
Entry
100673540         CDS       T04351                                 

Gene name
HDAC2
Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04213  Longevity regulating pathway - multiple species
lav04330  Notch signaling pathway
lav04613  Neutrophil extracellular trap formation
lav04919  Thyroid hormone signaling pathway
lav05016  Huntington disease
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05165  Human papillomavirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05206  MicroRNAs in cancer
lav05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100673540 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100673540 (HDAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100673540 (HDAC2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100673540 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100673540 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100673540 (HDAC2)
   05202 Transcriptional misregulation in cancer
    100673540 (HDAC2)
   05206 MicroRNAs in cancer
    100673540 (HDAC2)
   05203 Viral carcinogenesis
    100673540 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100673540 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100673540 (HDAC2)
  09165 Substance dependence
   05031 Amphetamine addiction
    100673540 (HDAC2)
   05034 Alcoholism
    100673540 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100673540 (HDAC2)
   05165 Human papillomavirus infection
    100673540 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100673540 (HDAC2)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100673540 (HDAC2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100673540 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     100673540 (HDAC2)
    BRAF-HDAC complex
     100673540 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100673540 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    100673540 (HDAC2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 100673540
NCBI-ProteinID: XP_003404327
LinkDB
Position
Unknown
AA seq 488 aa
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARLEEDKKETEDKKADVKEEDKSKDSSGEKTDSKGT
KSEQLSNP
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgtacagtcagggaggcggcaaaaagaaagtctgctactactacgatggtgatatt
ggaaattactattatggacagggccatcctatgaaacctcacagaatccgcatgacccat
aacttgctcctaaattatggcttatatagaaaaatggaaatatatagaccccataaagca
actgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctgcgttcaata
agaccagataacatgtctgagtatagtaaacagatgcagagatttaatgttggagaagat
tgcccagtgtttgatggactctttgagttttgtcagctctcaactggtggctcagttgct
ggggctgtgaagttaaaccgacaacaaactgatatggctgttaactgggctggaggatta
catcatgctaagaaatcagaagcgtcaggattctgttatgttaatgatattgtgcttgcc
atccttgaattgctaaagtatcatcagagagtcttatatattgatattgatatccatcac
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgactgtatcattccat
aaatacggggaatactttcctggcactggagatttgagggatattggtgcaggaaaaggc
aaatactatgctgttaattttccaatgagagatggtatagatgatgagtcatacgggcag
atatttaagccaattatctcaaaagtgatggagatgtatcaacctagtgctgtggtatta
cagtgtggtgcagactcattatctggtgatagacttggctgcttcaatctaacagtcaaa
ggtcatgctaagtgtgtagaagttgtaaaaactttcaacttaccattgctgatgcttggg
ggaggcggatacacaatccgtaacgttgctcgatgttggacgtatgagactgcggttgcc
cttgattgtgagattcctaatgagttgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccatcaaacatgacaaaccagaacactccagaatatatg
gaaaaaataaaacagcgtttatttgaaaatttacgcatgttacctcatgcaccgggtgtc
caaatgcaagctattccggaagatgctgttcatgaagatagtggagacgaagatggagaa
gatccagacaagagaatttctattcgagcatcagataagcggatagcctgtgatgaagaa
ttctcagattctgaggatgaaggagaaggaggtcgtagaaatgtggctgatcataagaaa
ggagcaaagaaagctagacttgaagaagacaagaaggagacagaggacaaaaaagcagat
gttaaagaagaagataaatccaaggacagtagcggtgaaaaaacagattccaaaggaacc
aaatcggaacagctcagcaacccttga

DBGET integrated database retrieval system