KEGG   Loxodonta africana (African savanna elephant): 100666867
Entry
100666867         CDS       T04351                                 

Gene name
MEN1
Definition
(RefSeq) menin isoform X2
  KO
K14970  menin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04934  Cushing syndrome
lav05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100666867 (MEN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100666867 (MEN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100666867 (MEN1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    MLL-HCF complex
     100666867 (MEN1)
SSDB
Motif
Pfam: Menin
Other DBs
NCBI-GeneID: 100666867
NCBI-ProteinID: XP_003419658
LinkDB
Position
Unknown
AA seq 610 aa
MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPE
LTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKK
VSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSED
HAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMV
CAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLT
LYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYCREDEEI
YKEFFEVANDVIPNLLKEAATLLEAGEERPGEQAQGTQSQGSALQDPECFAHLLRFYDGI
CKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRR
RGPRRESKPEEPPPPKKLALDKGPGAGQGAVPGPPRRPPATSPGTARGPEGGSAGPAPVP
AASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTL
SFLKRQRKGL
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgggcctgaaggccgctcagaagacgctctttccgctgcgctccatcgacgacgtagtg
cggctcttcgctgctgagctgggccgggaggagccagacctggtgctcctgtccttggta
ctgggcttcgtggagcattttctggctgtcaaccgggtcatccccaccaacgtgcctgag
ctcaccttccagccaagccctgcgcccgacccccctggcggcctcacctacttccccgta
gctgacctatccatcatcgctgccctgtatgcccgcttcactgcccaaatccgcggtgcc
gtcgacctgtccctctacccccgggaggggggtgtctccagccgtgagctggtgaagaag
gtctccgatgtcatctggaacagcctcagccgttcctacttcaaggaccgggcccacatc
cagtccctcttcagcttcatcacaggcaccaaactggacagctccggtgtggcctttgct
gtggtgggggcctgccaggccctgggtctccgggatgtccacctggccctgtctgaggac
catgcctgggttgtgtttgggcctaacggggagcagacagctgaggtcacctggcatggc
aagggcaacgaggatcgcaggggccagacagtcaacgcgggtgtggccgagcggagctgg
ctgtacctgaaaggatcatacatgcgctgtgaccgcaagatggaggtggcatttatggtg
tgcgccatcaacccttccattgatctacacactgactcactggagctgctgcagctgcag
cagaaactgctgtggctgctctatgacctgggacacctggaaagataccccatggcactg
gggaacctggcagatctggaggaactggagcctactcctggccggccggacccactcact
ctctaccataagggcattgcctcagccaagacctactaccgggatgagcacatctacccc
tatatgtatctggctggctatcactgtcgcaaccgcaatgtgcgtgaagctctgcaggcc
tgggccgacacagccactgtcatccaggactacaactactgccgtgaagatgaggagatc
tacaaggagttctttgaagtagccaatgacgtcatccccaacctgctgaaggaggcagcc
accctgctggaggcaggcgaggagcggccaggggagcaggcgcagggcacccagagccag
ggttctgccctccaggaccctgagtgcttcgcccacctgctgcgcttctacgatggcatc
tgcaaatgggaggagggcagccccacgccggtgctgcacgtcggctgggccaccttcctc
gtgcagtcccttggccgttttgagggacaggtgcggcagaaggtgcgcattgtgagtcgg
gaggctgaggcagcagaggctgaggagccctggggcgaggaggcccgggaaggccggcga
cgcggtccgcggcgggagtccaagcctgaggagccgccgccgcccaaaaagctggcgctg
gacaagggcccaggcgctgggcagggtgcggtgccaggaccgccccggaggcccccagcg
accagcccgggtactgcccgtggccctgagggaggcagcgcgggcccggcacctgtgcct
gctgcgtcaccgccaccggagggcccggtgctcacgtttcagagcgagaaaatgaagggc
atgaaggagctgctggtggccaccaagatcaactcgagcgccatcaagctgcagctcaca
gcgcaatcgcaggtgcagatgaagaagcagaaggtatccacgcccagcgattacacactg
tctttcctcaagcggcagcgcaagggcctctga

DBGET integrated database retrieval system