KEGG   Loxodonta africana (African savanna elephant): 100667005Help
Entry
100667005         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: transmembrane protease serine 9-like
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lav01002]
    100667005
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100667005
Peptidases [BR:lav01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100667005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 100667005
NCBI-ProteinID: XP_023398491
LinkDB All DBs
Position
Unknown
AA seq 833 aa AA seqDB search
MPSFPSTPNTGQSPPRDPVSTLQMSTCSAVVLLQFLSSFQKTELEATCVGCTVLSYRFQQ
RGALPEDFFPTYRDGNTSVLVRFRLHFLLRAVHTLSLGMEEQVLQQGLRARLGDHGVPLA
AYGTIVSAELTGSQMEPLTERDLKSGHCPGNAFSCGNSQCVSKVNPECDNRVDCADGSDE
AHCDCGLQPAWRMARRIVGGVEASPGEFPWQVSLRENDEHFCGAAIVGARWLVSAAHCFN
EFQHQTEWVAYVGTTYLGGSEASTVRARVSRIIKHPLYNADTADFDVAVLELAGPLPFSR
HIQPVCLPAASHSFPPRKKCLISGWGYLKEDFRKRVLFDLVYYFVCCGFYYYYYFFGKNI
HSKTHSHSTTSRHTDQGVTSVTFFTLCHCSPYSCSLCFTSVDLNSLPPKPTKPDILRKXS
VGIIDQKTCSALYNFSLTDRMICAGFLEGKADSCQGDSGGPLACEETPGVFYLAGIVSWG
IGCAQAKKPGVYARITRLKGWILETMSSDPLPMAPPSTARTPTAPSHARRTTAGLTVLGA
TTSRATPQTTSRATHPPPTTTVSLMSTTTRRQTPLPNTPEPSAHSQLSDCGRAPVAALTR
IVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWGAFLGTP
FLSGADGQLERVARIYKHPFYNLYTLDYDVALLELAGPVRRSRLVRPICLPDPAPRPPAG
ARCVITGWGSVREGGAMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCS
GDAGGPLACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIKQNVQD
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgccctccttccccagcaccccaaacacaggacagagccccccacgggacccagtgtcc
acgctgcagatgtcgacgtgtagtgctgtggttttgttgcagtttttaagtagcttccag
aagacggagctggaggccacctgcgtgggctgcacggtgctgagttacagattccagcag
agaggagccctccctgaggacttcttccccacctacagggatggaaacaccagcgtcctg
gtgcggttccggctgcacttcctgctgcgagctgtccacacgctgagcctgggcatggag
gagcaagtcctgcagcaggggctgcgggccaggcttggggaccatggggtccccttggct
gcctacggcaccatcgtgtccgccgagctcactggaagccaaatggagccacttacagaa
agagacttaaaatcaggtcattgtcctggaaacgccttttcctgtgggaacagccagtgt
gtcagcaaggtgaacccagagtgtgacaacagagtggactgtgccgacggctccgatgag
gcccactgtgactgtggtttgcaacctgcctggaggatggccaggaggatcgtgggcggt
gtggaagcgtccccaggggagttcccgtggcaagtcagcctccgtgaaaacgacgagcac
ttctgtggggccgccatcgtgggcgcgagatggctggtgtctgccgcccactgcttcaac
gaattccagcaccagacagagtgggtggcctacgtgggcacgacctacctcggtggctcg
gaggccagcaccgtgcgggcccgggtctctcggatcatcaagcaccccttgtacaacgcc
gacacggccgacttcgacgtggcggtgctggagctggccggcccgctgcccttcagcaga
cacatccagcccgtgtgcctcccggccgcctcgcacagcttcccaccccggaaaaagtgc
ctcatctccggctggggctacctcaaggaggacttccgtaagcgtgtcttgtttgatctc
gtttattattttgtgtgttgcggtttttattattattattatttttttggtaaaaatata
cacagcaaaacccactcccattccaccacttctagacatactgaccagggagtgacgtca
gtcacattcttcacattgtgtcactgttctccttattcctgttctctttgtttcacttct
gttgacttaaactccctgccccccaaaccgaccaagcctgacattctacgaaaancctcg
gtggggatcatagaccagaagacgtgcagcgccctctacaacttctccctcactgaccgg
atgatctgtgccggcttcctggaaggcaaggctgattcctgccagggtgactccggaggc
cccctggcctgtgaggagacccctggcgtgttctacctggcagggatcgtgagctgggga
attggctgtgcccaggccaagaagccaggggtgtacgcacggatcaccaggctgaagggg
tggatcctggagaccatgtcctctgaccccctccccatggctcccccctcaacagcaagg
acacccaccgccccaagccatgcccggaggacgaccgctggcctcacagtcctgggagcc
acgaccagcagagccacgccccagaccaccagcagggccacccacccgcctcccaccacc
accgtctccctcatgagcaccaccaccaggagacaaacgccacttccaaataccccagag
cccagcgcacactcccagctctcagactgtggccgggcccccgtggcggcgctgaccagg
atcgtgggcggcagcgcggcgggccgcggagagtggccgtggcaggtgagcctgtggctg
cggcgccgagagcaccgctgcggcgccgtgctggtggccgagagatggctgctgtcggcg
gcgcactgcttcgacgtctacggagaccccaagcagtggggggcctttctgggcacgccg
ttcctgagcggggccgacgggcagctggagcgcgtggcgcgcatttacaagcatcccttt
tacaacctctacacgctggactacgacgtggcgctgctggagctcgcggggcctgtgcgc
cgaagccgcctggtgcggcccatctgcctgcccgaccccgcgccccggcccccggccggc
gcgcgctgcgtcatcaccggctggggctcggtgcgcgagggaggcgcgatggcgcggcag
ttgcagaaggcggcggtgcggctcctgagcgagcagacgtgccgccgcttctacccagtg
cagatcagcagccgtatgctgtgcgccggcttcccgcagggcggcgtggacagttgttcg
ggtgatgctgggggacccctggcttgcagggagccttcaggccggtgggtgctaacaggg
gtcaccagctggggctacggctgcggacgtccccacttcccaggtgtctacactcgggtg
gcagctgtgagaggatggatcaagcaaaacgtccaagactga

DBGET integrated database retrieval system