KEGG   Loxodonta africana (African savanna elephant): 100667008
Entry
100667008         CDS       T04351                                 

Gene name
TSC1
Definition
(RefSeq) hamartin isoform X1
  KO
K07206  tuberous sclerosis 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04218  Cellular senescence
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05168  Herpes simplex virus 1 infection
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100667008 (TSC1)
   04151 PI3K-Akt signaling pathway
    100667008 (TSC1)
   04152 AMPK signaling pathway
    100667008 (TSC1)
   04150 mTOR signaling pathway
    100667008 (TSC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100667008 (TSC1)
  09143 Cell growth and death
   04218 Cellular senescence
    100667008 (TSC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100667008 (TSC1)
  09149 Aging
   04211 Longevity regulating pathway
    100667008 (TSC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100667008 (TSC1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100667008 (TSC1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100667008 (TSC1)
   05163 Human cytomegalovirus infection
    100667008 (TSC1)
   05165 Human papillomavirus infection
    100667008 (TSC1)
SSDB
Motif
Pfam: Hamartin ATG16 Vps54_N TMF_DNA_bd DUF1664
Other DBs
NCBI-GeneID: 100667008
NCBI-ProteinID: XP_023400548
LinkDB
Position
Unknown
AA seq 880 aa
MTQQTSIGELLSMLDSSKLGVLDDITTVFKENLNSDRGPMLVNTLVDYYLETNSQPALHI
LTTLQEPHDKHLLDKINEHVGKATTRLSTLSLLGHVIRLQPSWKHKLSQAPLLPSLLKCL
KTDTDVVVLTTGVLVLITMLPMIPQSGKQHLHDFFDIFGRLSSWCLKKPGHVTEIYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENLETFEEVIKPMMEHVRIHPELVTGSKDH
ELDPRRWKRLETHDVVIECAKISLDPTEASYEDGYSVSHQISARFPHRSADVTTSPYVDT
QNSYGSATSTPYSTSRLTLNTPGQLPQTLSSLSTRLLTEPPQATFWSPSMVCGMTTPPTS
PGNVPPELLHPYSKVFGTTAGGKGTPLGTPATSPPPAPLCHSDDYVQAAATPSKREERTD
SARLCLHRENHHPNDRGLEETPGSKGSVTLSDLPGFLGDLASEEDSIEKDKEEAAISKEL
SEITTTDAEPVVPRGGFDSPFYQDSLPGSQRKIHSAASGAPSVNVNPEPLNSSLDKLGPD
TPKQTFTPIDLPCGGADESPVGTRERQTSLETSILTPSPCKIPPQRGVGFGSGQPPPYDH
LFEVALPKTAYHFVSKKTEELLKKAKGNTEEDYVPSTSPMEVLDRLIQQGADAHTKELNK
LSLPSKSVDWTHFGGSPPSDEIHTLRNQLLLLHNQLLYERFKRQQHALRNRRLLRKVIRA
AALEEHNAAMKDQLKLQEKDIQIWKVSLQKEQARYSQLQEQRDTVVAQLHSQIRQLQHDR
EEFYNQSQELQTKLEDCRNIIVELRTELKKANNKVCHTELLLSQVSQKLSNSESVQQQME
FLNRQLLVLGEVNELYLEQLQNKHADTTKVCWGLGEAKPV
NT seq 2643 nt   +upstreamnt  +downstreamnt
atgacccaacaaacgagtatcggggagctcctctccatgctggactcctctaagctgggt
gtgctagatgacataacaacggtctttaaagagaacctcaattccgaccgaggtcctatg
cttgtaaacaccttggtggattattacctggaaaccaattctcagccagcattgcacatc
ctgactacgttgcaagagccacatgataagcacctcttagacaagattaacgaacacgtg
ggcaaagccaccactcgtttatccaccctctctctcctggggcatgtgatacgactacag
ccatcgtggaagcacaagctctctcaagcacctcttttgccttctttactaaaatgtctc
aagactgacaccgatgtagtagtcctcacaacgggagttttagtgttgataaccatgcta
ccaatgattccacagtccgggaaacagcaccttcatgacttctttgatatttttggccgt
ctttcatcctggtgcctgaagaaaccaggccatgtgacagaaatctatcttgtccatctc
catgccagtgtttatgctctctttcatcgcctttatggaatgtacccttgcaactttgtc
tcctttctacgttctcactacagtatgaaggaaaacttggagacttttgaagaagtgatc
aagccaatgatggagcatgtgcgaattcatccggaattagtgactggatccaaggaccat
gaactggaccctcgaaggtggaagagattagaaactcacgatgttgtaatagagtgtgcc
aaaatctctctggaccctacagaagcctcatatgaagatggctattctgtgtctcaccaa
atctcagcacgctttcctcatcgttcagctgatgtcaccaccagcccttatgttgacaca
cagaatagctatgggagtgctacttctaccccttactccacttcccggctgacgttaaat
acgccagggcagctacctcagactctgagttccctatcaacacggctgttaactgagccg
ccacaagctactttttggagcccatctatggtttgtggtatgaccactcctccaacttct
cctggaaacgtcccacctgagttgttacacccttacagtaaagtctttggtacaactgca
ggcggaaaaggaacccctctgggaaccccagccacctctcctcctccagccccactctgc
cattcggatgactatgtgcaggccgcagccacaccctccaaaagggaagagagaacagat
tctgcaagactgtgtctacacagagagaaccatcatcctaatgacagaggattagaagag
acacctggcagcaaaggttctgtcactctcagtgatcttccagggtttttaggtgatctg
gcctctgaagaagatagtattgaaaaagataaagaagaagctgcaatatctaaagaactt
tctgagatcactacaacggatgctgagcctgtggttccccgaggcgggtttgactctcct
ttctaccaagacagtctcccaggttctcagcggaagatccattcagcagcctctggtgcg
ccaagcgttaatgtgaaccctgagcctttaaactcctccctggacaagcttgggcctgac
acaccaaagcaaacctttactcccatagacctgccctgtggaggtgccgatgaaagtcct
gttgggaccagggaacgccagacttctttggagacgagtatcctcactcccagcccttgt
aaaattccacctcagaggggagtggggtttggaagtgggcagcctcccccatatgatcat
ctttttgaggtggcattgccaaagactgcctatcattttgtcagcaagaagaccgaggaa
ctattaaaaaaggcaaaaggaaacacagaggaagattatgtgccctctacctccccaatg
gaagtactggatagactgatacagcagggagcagatgcacacaccaaggagcttaacaag
ttgtctttacccagcaagtctgtcgactggacccactttggaggctctcctccctcagat
gagatccacaccctccgtaaccagctgcttttactgcacaaccagttactctacgagcgt
tttaagaggcagcagcatgctctccggaacaggcggctcctccgtaaggtgatccgtgcg
gcagctctggaggaacacaacgctgctatgaaagatcagttgaagttacaagagaaggac
atccagatatggaaggttagtctgcaaaaagaacaagccagatacagtcagcttcaggag
cagcgtgacactgtggtagcccagctccatagccagatcagacaactgcaacatgaccga
gaagaattctacaaccagagccaggaattacagacaaagctggaagactgcaggaacatt
attgtggagctgcggacagaattaaagaaagccaacaacaaggtgtgtcacaccgagctg
ctgctcagtcaggtttctcaaaagctctcaaatagtgagtcggtccaacaacagatggaa
ttcttgaacaggcagctgttagttcttggggaggtcaacgagctgtacttggaacagctg
cagaacaagcatgcagacaccacaaaggtatgctgggggttgggggaagctaaacctgta
taa

KEGG   Loxodonta africana (African savanna elephant): 100670924
Entry
100670924         CDS       T04351                                 

Gene name
TSC2
Definition
(RefSeq) tuberin isoform X4
  KO
K07207  tuberous sclerosis 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04072  Phospholipase D signaling pathway
lav04115  p53 signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04218  Cellular senescence
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05168  Herpes simplex virus 1 infection
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100670924 (TSC2)
   04151 PI3K-Akt signaling pathway
    100670924 (TSC2)
   04152 AMPK signaling pathway
    100670924 (TSC2)
   04150 mTOR signaling pathway
    100670924 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100670924 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100670924 (TSC2)
   04218 Cellular senescence
    100670924 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100670924 (TSC2)
   04919 Thyroid hormone signaling pathway
    100670924 (TSC2)
  09149 Aging
   04211 Longevity regulating pathway
    100670924 (TSC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100670924 (TSC2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100670924 (TSC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100670924 (TSC2)
   05163 Human cytomegalovirus infection
    100670924 (TSC2)
   05165 Human papillomavirus infection
    100670924 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100670924 (TSC2)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100670924 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Cnd1 HEAT
Other DBs
NCBI-GeneID: 100670924
NCBI-ProteinID: XP_010595718
LinkDB
Position
Unknown
AA seq 1745 aa
MAKPTSKDSGLKEKFKILLGLGTPRPHPRSAEGRQTEFIITAEILRELSVECGLNNRIRV
IGQICEVAKTKKFEEHAVEALWKAVADLLQPDRPPEARHAVLALLKAIVQGQGDRLGVLR
ALFFKVIKDYPSNKDLHERLEVFKALTDNGRHITYLEEELAEFVLQWMDVGLSSEFLLVL
VNLVKFNSCYLDEYIASMVHMICLLCIRTSSSVDIEVSLQVLDAVVCYNCLPAASLPLFI
VTLCRTVNVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRAYMEDAPLLRGAVFFVG
MALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRKELQAVTWDI
LLSIIERLLQQLLTLESQELRAIVHDLLTTVEELCDQNEFHGSQERYFELIERCADQRPE
SSLLNLISYRAQSIHPAKDDWIHNLQQLMERFFRNESRSAVRIKVLDILSFVLLINRQFY
EEELINSVVISQLSHIPEDRDPQVRKLATQLLVDLAEGCHTHHFNNLLDIIEKVIARSLF
PPPELEERDVPAYSASLEDVKTAVLGLLVILQTKLYTLPASHAARVYEMLVHHIQLHYKH
MYTLPIASSIRLQAFDFLLLLRADALHRLGLPNKDGAVRFSSYCLCDHMEPEHGLEKKAS
GPVSPPTGPTVPAPAGPTVRLGYLPYSLLFQVLLQCLKQETDWKVLKLVLSKLPESLRYK
VLIFTSPCSVDQLSSALCSMLSGPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYL
DKTKQREMVYCLEQGLIYRCASQCVVALAVCSVEMPDVIIKALPVLIVKLTHISATASMA
IPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSRIQTSFTSASLGSA
DENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVG
NKLVTVTTSVGTGTRSLLGLDPGELQGGSELSSSPGVHVRQTKEAPAKLESQAGVQVCRR
ARDRVRSMSGGHGLRVGALDTLASYFPGGPICPGPQTMPVVKPQKASASTQMPVPKEKTN
LAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFK
EHRDTALYKSLSVPVASASKPSLLPRSNTDSPGVLEEGCAGEMNLSTELPELEDFKAASG
SDRRSQRTDAYSRSSSISSQEEKQLCAEELAARGIPIEQVVSSRGGQPCVDLSFQPSQPL
SKSSSSPELQTLQDIFGDAGDKADGGWLSPEAKARWQSGTLDGECAAWLAPGEEGRAHAP
AQHEGSLPCSSPRSPHGLRPRGYTISDPVQLRRGKTVERDTSNSRAAASNAEKVPGINPS
FVFLQLYHSPFFGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSELA
ILSNEHGSYRYTEFLTGLGKLIELKDCQPDKVYLGGLDVGGEDGQFTYCWHDDIMQAVFH
IATLMPTKDGDKHRCDKKRHLGNDFVSIVYNDSGEDFRLGTIKGQFNFVHVIITPLDYEC
NLVSLQCRKDMEGLVDTSMAKIVSDCNLPFVARQMALHANMASQVHHSRSNPTDIYPSKW
IARLRHIKRLRHRIREEANYLNPSLPLVQMHPPANTKAPAEATPTYETGQRKRLISSVDD
FTEFV
NT seq 5238 nt   +upstreamnt  +downstreamnt
atggccaagcccacaagcaaagattcaggcttgaaggagaagttcaagattctcctgggc
ctgggaacaccaaggccacatcccaggtctgcagagggcagacagacggagtttatcatc
acagcagaaatcctgagagaactgagtgtcgagtgtggtctgaacaatcgcatccgggtc
atagggcagatctgtgaagtagcaaaaactaagaagtttgaggagcatgccgtggaagca
ctgtggaaagctgtcgcggacttgctgcagccagaccggccaccagaggcacgacatgca
gtgctggccctgctcaaggccatcgtgcagggccagggtgaccgcctgggtgtgctccgt
gccctcttcttcaaggtcataaaggattacccttcgaacaaagacttgcacgaaaggctg
gaggtgttcaaggccctgacggacaatgggagacacataacctacttggaagaagagctg
gctgagtttgtcctgcagtggatggatgtgggcttatcctcagaattcctgctggtgctt
gtgaacctggtcaagttcaacagctgttaccttgatgaatacatcgcatccatggttcac
atgatctgtctgttgtgcatccggacctcgtcctccgtggacatagaggtgtccctgcag
gtgctggatgccgtggtctgctacaactgcctgcctgccgcgagcctgcccctattcatt
gtcacattgtgccgcaccgtcaacgtcaaggagctctgcgagccctgctggaagctgatg
cgtaacctcctgggaacccacctgggccacagtgccatctacaacatgtgccgcatcatg
gaggacagagcctatatggaggatgccccgctgctgagaggagctgtgttctttgtcggc
atggcgctgtggggggcccaccgactctactccctcaagaactcccctacatctgtgctg
ccgtcgttttatgaggccatgacctgccccaatgaggtggtgtcctacgaaatcgtcctc
tctatcaccagactcatcaagaagtacaggaaggagctgcaggctgtgacgtgggacatc
ctgctgagcatcatcgaacgtctgctccagcagctcctgaccctcgagagtcaggagctc
agagccatcgtgcatgacctgctgacgacggtggaggagctgtgtgaccagaatgagttc
cacggctcacaggagagatactttgagctcattgagcgatgcgccgaccagagacctgag
tcctccctcttgaacctgatatcctacagggcacagtccatccacccagccaaggatgac
tggatccacaacctgcagcagttaatggagaggttcttcaggaacgagtcccgcagtgct
gtgcgcatcaaggtgctggacatcctgtcctttgtgctgcttatcaaccggcagttctat
gaggaggagctgatcaactcagtggtcatctcccaactctcccacattccagaagacaga
gacccacaggtccgcaagctggccacccagttgctggtggacctggcggaaggctgccac
acccaccacttcaataatcttctggacatcattgagaaagtgattgctcgctccctgttc
cctcctcctgagctagaagaaagagatgtgcctgcgtactcggcctccttggaggatgtg
aagactgcggtcctggggctcctggtcatccttcagaccaagctctacactttgcctgcc
agccatgcagcacgggtatacgagatgcttgtccaccacatccagctgcactacaagcac
atgtacaccttgcccattgccagcagcatccggcttcaggcctttgacttcctgctgctg
ctccgggcagatgcactacaccgcctgggcctgcctaacaaggatggtgctgtacggttc
agctcctactgcctctgtgaccacatggagccagagcacggcttggagaagaaggccagt
ggccccgtctcgcctcccacggggcctaccgtcccagcacctgcaggccccactgtgcgg
cttggctatctgccctactccttgctcttccaagtcctgctgcagtgtctgaagcaggag
acggactggaaggtgctgaagctggtactcagcaagctgccggagtccctgcgctacaag
gtcctcatcttcacatccccctgcagcgtcgaccagctgtcctctgccctctgctccatg
ctttcaggtcccaagaccctggaacgactccgaggcacaccagagggcttctctagaacc
gacttacacttggcagtggttccagtgttgacagcactgatctcttaccataactacctg
gacaaaaccaaacagcgcgagatggtgtactgcttggagcaaggcctcatctaccgctgt
gccagccaatgtgtggtggccctggctgtgtgcagtgtggagatgcctgacgtcatcatc
aaggcactgcccgtactgattgtaaagctcacgcacatctcggccacagccagcatggcc
atcccgctgctcgagttcctgtcgactctggcccggctgccgcatctctacaggaacttt
gctgctgagcagtacgccagcgttttcgccatttcactgccctacaccaacccatccaaa
ttcaatcagtatattgtgtgcctggcccaccacgtgatagccatgtggttcattcggtgc
cgcctgcccttccggaaagattttgttccgtatatcactaagggccttcgctccaatgtc
ctcctgtcttttgatgacacccccgagaaggacagcttcagggcacggagcaccagtctc
aacgagaggcccaaaagtaggatccagacctccttcaccagtgccagcttgggttctgca
gacgaaaactcgatggcccaggcagacgacaacctgaaaaatctccacctggagctcacc
gagacgtgcctggacatgatggccagatacgtgttctccaacttcacagctgtccccaag
aggtctcccgtgggagaattcctcctggctggaggcaggaccaaaacctggctggtgggg
aacaagctggttaccgtaacgacgagtgtgggaactggcacacggtcgctgctgggccta
gacccaggcgagctgcagggtggctcagagcttagctccagccctggtgtacacgtgagg
cagacgaaagaggcgccagccaagctggagtcccaggctggggtacaggtgtgccgcagg
gcccgggaccgggtccgctccatgtcaggtggccatggcctgcgcgtgggagccctggac
actctagcctcctacttccctggaggccctatttgtccagggccgcagaccatgccggtc
gtgaagcctcagaaagcctcagcgagcacccagatgccagtgccaaaggaaaagacaaac
ctggctgcctacgtgcccctcctgacccagggctgggctgagatcctggtccggaggccc
acagggaacaccagttggttgatgagcctggagaatccactaagccctttctcttcggac
atcaacaatatgccactgcaggagttgtccaatgctctcatggccgctgagcgcttcaag
gagcaccgtgacacggccctgtacaagtcattgtcggtgccagtggccagcgcctccaag
ccctccctcctgccccgctccaacacagactccccgggggttctggaggaaggatgtgca
ggtgagatgaacttgtccactgagcttcctgagcttgaggacttcaaggcagcctcaggt
tcagacaggcgctcccagcgtaccgatgcttacagtaggtcatcttcgatctccagccaa
gaggagaagcagctgtgtgcagaggagctggctgccaggggaatccccattgagcaggtg
gtgtcctccaggggtggccagccctgtgtggacctctcctttcagccctcgcagcctcta
agcaaatccagctcctcacccgaactgcagaccttgcaggacatctttggggacgctggg
gacaaggccgatggaggctggctgagccctgaggccaaggcccggtggcagtcggggacc
ctggatggggagtgtgctgcctggctggctccaggtgaggagggccgggcccatgcccca
gcccagcacgagggctcactgccctgcagctccccacgctccccacacggcctgcggccc
cgaggctacaccatttccgacccagtccagttgcgcaggggcaagacagtggagagagac
acctccaacagccgagctgctgcctccaacgcggagaaggtgccaggcatcaaccccagc
tttgtgttcctgcagctctaccactcgcccttctttggggacgagtccaacaagccaatt
ctgttacccaacgagtccttcgagcgctcggtgcagctccttgaccagatcccttcgtat
gacacacacaagatcgctgttttgtacgtgggagagggccagagcaacagtgagctcgcc
atcctctccaacgagcacggctcctacaggtatacagaattcctgacgggcctgggcaag
ctcattgagctcaaggactgccagcctgacaaggtgtacctgggtggcttggatgtgggc
ggcgaggacggccagttcacctactgctggcatgatgacatcatgcaagcagtctttcac
atcgccaccctgatgcccaccaaggatggggacaagcaccgctgtgacaagaagcgccac
ctgggcaatgactttgtgtccattgtctacaacgactctggcgaggacttcaggctgggc
accatcaagggccagttcaacttcgtgcatgtgattatcactcctctggactatgagtgc
aacctggtctcactccagtgccggaaagacatggagggcctggtggacaccagtatggcc
aagatcgtgtctgactgtaacctgcccttcgtggcccgccagatggccttgcatgccaac
atggcctcccaggtccaccacagccgctctaaccccactgacatctacccttccaagtgg
attgcccggctccgccacatcaagcggctacgtcaccggatccgggaggaagccaattac
ctgaaccctagcctgcctctggtgcagatgcatcctccggccaacaccaaggcccctgca
gaggccacacccacctatgaaaccggccagagaaagcgcctcatctcctcagtagacgac
ttcacagaatttgtgtga

DBGET integrated database retrieval system