KEGG   Loxodonta africana (African savanna elephant): 100667029
Entry
100667029         CDS       T04351                                 

Gene name
KCNA4
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 4
  KO
K04877  potassium voltage-gated channel Shaker-related subfamily A member 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100667029 (KCNA4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100667029 (KCNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100667029 (KCNA4)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100667029 (KCNA4)
SSDB
Motif
Pfam: Ion_trans K_channel_TID BTB_2 Ion_trans_2 PKD_channel DctQ
Other DBs
NCBI-GeneID: 100667029
NCBI-ProteinID: XP_003412355
LinkDB
Position
Unknown
AA seq 654 aa
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGG
SHHHHQSRGACISQDPQSGRGSRRRRRQRLEKKKVHHRQSSFPHCTDLMPSGSEEKILRE
LSEEEEDEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDDGGGGGYSSVRYSDCCERVV
INVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGG
RLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEY
PESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLIMALSSGGHSGLLNDTSTPHP
ENAGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITL
GTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELG
LLIFFLFIGVILFSSAVYFAEADEPTTNFQSIPDAFWWAVVTMTTVGYGDMKPITLGGKI
VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRS
STSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNVKAVETDV
NT seq 1965 nt   +upstreamnt  +downstreamnt
atggaggttgcaatggtgagtgccgagagctcagggtgcaatagtcatatgccttacggt
tatgcagcccaggcccgggcccgggagcgggagaggcttgctcactcaagggcagctgca
gcagctgctgtcgctgcggccacagctgctgttgaaggcagtgggggctctggagggggc
tcccaccaccaccaccagtcacgtggggcctgtatctctcaagaccctcagagtggccgg
ggcagtcggaggaggaggcgacaacggcttgagaagaagaaagtccatcaccgtcaaagc
agctttcctcattgcactgacctgatgcccagtggctctgaggagaagatcctgagggag
ctgagtgaagaagaggaagatgaagaggaggaggaggaggaggaagaggagggaaggttt
tattatagtgaagatgaccatggtgatgaatgttcctacacagacctgctgcctcaggat
gatgggggaggcggtggctatagttcagttcgctacagtgactgttgtgaacgtgtggtg
ataaatgtgtcaggcttacgctttgagacccagatgaaaactctggcccagtttccagag
actttgttgggagaccctgagaagaggactcaatactttgaccctttgcgcaacgagtat
ttttttgacagaaaccggcccagctttgatgctatcttgtattattaccaatcaggaggc
cgcctgaagagaccagtcaacgtcccttttgatatattcactgaggaggtgaagttctac
caattgggagaggaggccctgctcaaatttcgggaggatgagggtttcgtgagagaagag
gaggacagggcgctgccagagaatgaatttaaaaagcagatttggcttctctttgaatat
ccagagagctccagtccagcaaggggcatagccatcgtgtctgtcctggtcatcttaatc
tccattgttatcttttgcctggaaaccttgcctgagtttagggacgacagggatctcatc
atggcactgagctctggtgggcatagtgggttgttgaacgacacctcgacaccgcatccg
gagaacgcagggcacacgatattcaatgaccccttcttcattgtggagacagtctgtatt
gtttggttttcctttgagtttgtggtccgctgctttgcttgtcccagccaagcacttttc
ttcaaaaacatcatgaacatcattgacatcgtctccattttgccttactttatcacgttg
ggcactgatttggcccagcaacaggggggtggcaatgggcagcagcagcaggctatgtcc
tttgccattctcaggatcatccgtctggtccgagtattccggatcttcaaactctccagg
cactccaaaggcctgcagatcctgggccacaccctcagagccagcatgcgggaattgggc
cttctgatctttttccttttcattggggtcatcctgttttccagtgctgtatattttgca
gaagcagatgaacctactaccaatttccaaagcatcccagatgcattttggtgggctgtg
gtgaccatgacgactgtgggctatggggacatgaagcccatcactttggggggcaagata
gtggggtccctgtgtgccattgcaggtgtcttaaccattgctttgccagtgccagtgatt
gtctctaactttaactatttctaccacagagagactgaaaacgaggaacagacacagctg
acacagaatgcagtcagttgcccatacctcccttccaatttgctgaagaaatttcggagc
tctacttcttcttccctgggggacaaatcagagtatctagagatggaagaaggagttaag
gagtctctgtgtgcaaaggaggagaagtgtcagggaaaaggggatgacagtgagacagat
aaaaacaactgttctaatgtgaaggctgtggagactgatgtgtga

DBGET integrated database retrieval system