KEGG   Loxodonta africana (African savanna elephant): 100667099
Entry
100667099         CDS       T04351                                 

Gene name
NR5A1
Definition
(RefSeq) steroidogenic factor 1 isoform X1
  KO
K08560  steroidogenic factor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100667099 (NR5A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100667099 (NR5A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100667099 (NR5A1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100667099 (NR5A1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 Fushi tarazu-F1-like
    100667099 (NR5A1)
Nuclear receptors [BR:lav03310]
 5. Fushi tarazu-F1 like
  5A. Fushi tarazu-F1 like receptor
   100667099 (NR5A1)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 100667099
NCBI-ProteinID: XP_003407793
UniProt: G3TL19
LinkDB
Position
Unknown
AA seq 461 aa
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGTPMGVPPPPPPPQDYMLPPALHAPEPKGLPSGPPAGPLGDFGAPALPMAAPSTHGPL
AGYLYPAFPGRTIKSEYPEPYASPPQPGPPYGYPEPFSGGPGVPELILQLLQLEPDEDQV
RARIVGCLQEPAKGRPDQPAPFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQIQHGKEGSILLVTGQEVELTTVAAQAGSLLHSLVLRAQELVLQLHA
LQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTLCHYPHCGDKFQQLL
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggactattcgtacgacgaggacctggacgagctgtgccccgtgtgtggggacaaggtg
tccggataccactacggactgctcacgtgcgagagctgcaagggcttcttcaagcgcaca
gtgcagaacaacaagcactacacgtgcacggagagccagagctgcaagatcgacaagacg
cagcggaagcgctgtcccttctgccgcttccagaagtgcctgacggtggggatgcgcctg
gaagctgtgcgtgctgaccgcatgcggggaggccggaacaagtttgggcccatgtacaag
cgggacagagcccttaagcagcagaagaaggcacagattcgggctaatggcttcaagctg
gagacaggcaccccgatgggagtccccccaccaccccctcccccacaggactatatgctg
ccccctgccttgcatgcacctgagcccaagggcctgccctctggcccacctgctgggcca
ctgggtgactttggagccccagcgttgcccatggctgcgcccagcacccatgggcctctg
gccggctacctctatcctgccttccctggccgcaccatcaagtctgaatacccagagccc
tacgccagccccccacagcctggaccgccctacggctaccccgagcctttctctggaggg
cccggcgtgcccgagctcattctgcaactgctgcagctggagccggatgaggaccaggtg
cgggcacgcatcgtaggttgcctgcaggagccggccaaaggccgccccgaccagcctgcg
ccctttggcctcctgtgtaggatggctgaccagactttcatctccatcgtggactgggca
cgcaggtgcatggtcttcaaggagctggaggtggccgaccagatgacactgctgcagaac
tgctggagcgagctgctggtcttcgaccacatctaccgccagatccaacatggcaaagag
ggcagcatcctgctggtcaccgggcaggaggtggagctgaccacagtggctgcccaggca
ggctccctgctgcacagcctggtgttgcgggcgcaggagcttgtactgcagctgcacgcg
ctacagctggaccgccaggagtttgtctgcctcaagttcctcatcctcttcagcctcgat
gtgaagttcctgaataaccacagcctggtgaaggatgctcaggagaaggccaacgctgcc
ctgctcgattataccctgtgccactacccgcactgcggggacaagttccagcagctgctg
ctgtgcctggtggaggtgcgggcacttagcatgcaggccaaagaatacctgtaccacaag
cacctgggcaatgagatgcctcgcaacaatctgctcattgagatgctgcaagctaagcag
acttga

DBGET integrated database retrieval system