KEGG   Loxodonta africana (African savanna elephant): 100667129
Entry
100667129         CDS       T04351                                 

Gene name
HTR2C
Definition
(RefSeq) 5-hydroxytryptamine receptor 2C
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04540  Gap junction
lav04726  Serotonergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100667129 (HTR2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100667129 (HTR2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100667129 (HTR2C)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100667129 (HTR2C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100667129 (HTR2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100667129 (HTR2C)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100667129 (HTR2C)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 UPF0182 DUF1385 Pox_P21
Other DBs
NCBI-GeneID: 100667129
NCBI-ProteinID: XP_003414842
UniProt: G3SS51
LinkDB
Position
Unknown
AA seq 458 aa
MVNLKNAVHSLLVHLIGLLVWQCDISVSPVSALVTDIFNTSDGGRFKFPDGVQNWPALSI
VVIIIMTIGGNILVIMAVSLEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWIALDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIHV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTADEEDSANPNQDSNQRRRKKKDRRPRGTM
QAINNEKKASKVLGIVFFVFLIMWCPFFITNIMSVLCEKACNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKAEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVMKKASDSEPGIEMQVENLELPVNPSNVVSERISSV
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggtgaacctgaagaatgcggtgcattcgctccttgtgcacctaattggcctattggtt
tggcaatgtgatatttctgtgagcccagtttcagctctagtaactgacatttttaatacc
tccgatggtggacgcttcaaattcccagacggggtacaaaactggccagcactttcaatc
gtggtaataataatcatgacaataggtggcaacatcctcgttatcatggcagtaagcttg
gaaaagaaactgcacaatgccaccaattacttcctaatgtccctagccatcgctgatatg
ttggtgggactacttgtcatgccactgtctctgctggcaatcctttatgattatgtttgg
cccctgccaagatatttgtgccccgtctggattgctttagatgttttattttcaacagcg
tccatcatgcacctctgcgctatatcgctggatcggtatgtagcaatacgtaatcctatt
gagcatagccgtttcaattcgcggactaaggccatcatgaagattgctatagtttgggca
atttcaataggagtatcagttcctatcccagtgattggactgagggacgaaagcaaagtg
ttcgtgaacaacacgacctgcgtgctgaatgacccaaatttcgttcttattgggtccttc
gtagctttcttcattccgttgacgatcatggtgattacctactgtctgacgattcacgtc
cttcgaagacaagctttgatgttactgcacggccacaccgaggaaccacctggactaagc
ttggatttcttgaagtgctgcaagaggaatactgctgatgaagaagactccgcaaaccct
aaccaagattcgaaccaacgccgaagaaagaagaaagatcgacgtcctaggggcaccatg
caggctatcaacaacgaaaagaaagcttcaaaagtccttgggattgttttctttgtcttt
ctgatcatgtggtgcccgttctttattaccaatatcatgtcggttctgtgtgagaaggct
tgtaaccaaaagctcatggaaaagcttttgaatgtgtttgtttggattggctatgtttgt
tcaggaattaatcctctggtgtatacgctcttcaacaaaatttaccgaagggctttctcc
aattatttgcgctgcaattacaaggcagaaaaaaagcctccagtcagacaaattccgaga
gttgccgccactgctttatccgggagggagcttaatgttaacatttaccggcataccaat
gaaccggtgatgaagaaagccagtgacagtgagcccggtatagagatgcaagttgagaat
ttggagctaccagtaaatccctctaatgtagttagtgaaaggattagtagtgtgtaa

KEGG   Loxodonta africana (African savanna elephant): 100667507
Entry
100667507         CDS       T04351                                 

Gene name
HTR2A
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04540  Gap junction
lav04726  Serotonergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100667507 (HTR2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100667507 (HTR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100667507 (HTR2A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100667507 (HTR2A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100667507 (HTR2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100667507 (HTR2A)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100667507 (HTR2A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 100667507
NCBI-ProteinID: XP_023407076
LinkDB
Position
Unknown
AA seq 470 aa
MPIFCEENASLSLTPNSLSQLNDDTRFYDHNFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPPCYSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSELGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSHGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGAL
LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCRYKENKKPLQLILVNTIPALAYKS
SQLQTGQGKNAKKDAKTTENDCSLVALGKQQVEDTSTDNVNTMNEKVSCL
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcctattttttgtgaagaaaacgcttctttgagcttgactccgaactccttaagtcaa
ttaaatgatgacacaaggttctacgatcacaattttaactcgggagaagctaacacctcg
gatgcatttaactggacagtggactctgaaaatcggacaaacctgtcctgtgaaggctgc
ctctcaccaccgtgttactccttacttcatctccaggaaaaaaactggtctgctttgctg
acagctgtcgtgattattctaaccattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaacgccaccaactacttcctgatgtcacttgccatagctgat
atgctgctgggcttccttgtgatgcccgtgtccatgctaaccatcctgtatgggtaccgg
tggcctctgcccagcaagctgtgtgcggtctggatctacctggacgtgctcttctccacc
gcctccatcatgcacctgtgtgccatctcgctggaccgctatgtcgccatccagaaccca
atccatcacagccgcttcaactccagaacaaaggcctttctgaaaatcatcgctgtttgg
accatctcagtaggtatttccatgccaatacccgtctttgggctacaggatgattccaag
gtctttaaggaagggagttgcttacttgccgacgataactttgtcctgataggctccttt
gtgtcatttttcattcctttaaccatcatggtgatcacctactttttaactatcaagtca
ctccagaaagaagctactttgtgtgtgagtgagcttggcactcgggccaaactagcttct
ttcagctttctccctcagagctccctgtcttcagagaagcttttccagcgctccatccac
agggagccagggtcccacggcaggagaactatgcagtccatcagcaacgagcagaaggcg
tgcaaggtgctgggcatcgtcttcttcctgttcgtggtgatgtggtgtcccttcttcatc
accaacatcatggccgtcatctgcaaagagtcctgcaatgaggacgtcatcggagccctg
ctcaacgtgttcgtgtggatcggttacctctcctcagcggtcaacccacttgtgtacacg
ctgttcaataagacctacaggtcagctttttcacggtacattcaatgtcggtacaaggaa
aacaagaaaccgctgcagttaattttagtgaacactataccagccttggcctacaagtct
agtcaactccaaacaggccaggggaagaatgcaaagaaagacgccaagacgacagagaat
gactgctcgctggttgctctaggaaaacaacaggtagaagacacttctacagacaatgtc
aacacaatgaatgaaaaggttagctgtttgtga

KEGG   Loxodonta africana (African savanna elephant): 100673510
Entry
100673510         CDS       T04351                                 

Gene name
HTR2B
Definition
(RefSeq) 5-hydroxytryptamine receptor 2B
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04540  Gap junction
lav04726  Serotonergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100673510 (HTR2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100673510 (HTR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100673510 (HTR2B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100673510 (HTR2B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100673510 (HTR2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100673510 (HTR2B)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100673510 (HTR2B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx DUF1385
Other DBs
NCBI-GeneID: 100673510
NCBI-ProteinID: XP_023413531
LinkDB
Position
Unknown
AA seq 477 aa
MALSFRMSEQSTIPEHILQSTFDHLISSNQSGLQRESMPGEMKQTGEEQGTKPRWAALLI
LAVIIPTIGGNILVILAVSLEKKLQYATNYFLMSLAVADLLVGLLVMPIALLTIMFEPTW
PLPLILCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVWL
ISTGIAIPIPIKGIEADVGNLNITCALTKDRFGNFMLFGSLAAFFMPLAVMIVTYFLTIH
ALQKKVYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKTMPNSSDDVRR
MSTVGKKSVHTTSNEQRASKVLGIVFSLFLLMWSPFFITNVTLVLCDSCNQSILNKLLEI
FVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYQATKSLKALRKCSSKIYFQNPMTEN
SKFFTKHGMRNGINPVMYQSPVRLRSSAIQSSSVILLDTLFLTENEGDKTEEQVSYV
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggctctctcttttagaatgtccgaacaaagcacaatccctgagcacattctgcagagc
acatttgatcacttaatctcttctaaccagtctggattacagagagaatcaatgccaggg
gaaatgaaacagaccggtgaggaacagggaactaaaccgcgctgggccgcccttctgatc
ctcgcggtgataatacccacaattggtggaaacattcttgttattctggctgtttcactg
gagaaaaagctgcagtacgctaccaattattttctaatgtccctggcggtggctgatttg
ctggttggattgcttgtgatgccgattgctctcttgacaataatgtttgagccaacgtgg
cctctcccactcattctatgccctgcttggttatttctcgatgttctcttttctaccgca
tctatcatgcatctctgtgccatctcagtggatcgttacatagccatcaaaaagccaatc
caggccaatcaatataactcacgagctacagcattcatcaagatcacagtggtgtggttg
atttcaacaggcattgccattccaatccccattaaaggtatagaggctgatgtgggtaac
ctaaacatcacttgtgcgctgacaaaggaccgcttcggcaacttcatgctctttggctca
ctggctgccttcttcatgcctcttgcggtcatgattgtcacctactttctcaccatccat
gctttacagaagaaagtttacttggtcaaaaacaagccacctcaacgcctaacatggttg
accgtgtccacagttttccaaagagatgaaacaccttgctcatcgcctgaaaaggtggca
atgctggatggttctcgcaaggacaaaactatgcccaactcaagtgatgacgtacgaagg
atgtccacagttggaaaaaagtcagtgcatactacttccaatgaacagagagcctcaaag
gttctagggattgttttttccctctttttgcttatgtggagccccttttttattacaaat
gtaactttagttttatgtgattcttgcaaccagtctattctcaataagctcctggagata
tttgtgtggataggctacgtttcctcaggggtaaatcctttggtctataccctcttcaac
aagacatttcgagatgcctttggacgatacatcacttgcaattaccaggctacaaagtca
ttaaaagctcttagaaaatgctccagcaagatctacttccagaatccaatgacagagaac
tctaaatttttcacaaaacacggaatgagaaatgggattaatcctgtcatgtaccagagc
ccagtgaggctccgaagttcagccattcagtcttcatcagtcattctactagatacactt
tttctcaccgaaaatgaaggtgacaaaacagaagagcaagtcagttatgtttag

DBGET integrated database retrieval system