KEGG   Loxodonta africana (African savanna elephant): 100667228
Entry
100667228         CDS       T04351                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor protein 1
  KO
K06503  transferrin receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04066  HIF-1 signaling pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04216  Ferroptosis
lav04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100667228 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100667228 (TFRC)
   04145 Phagosome
    100667228 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    100667228 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100667228 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100667228 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100667228 (TFRC)
   04090 CD molecules [BR:lav04090]
    100667228 (TFRC)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   100667228 (TFRC)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100667228 (TFRC)
  Exosomal proteins of colorectal cancer cells
   100667228 (TFRC)
CD molecules [BR:lav04090]
 Proteins
  100667228 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 TFR_dimer PA Prominin
Other DBs
NCBI-GeneID: 100667228
NCBI-ProteinID: XP_010591195
LinkDB
Position
Unknown
AA seq 770 aa
MMNQARSAFSNLFSGQSLSYTRFSLARQVDGSNSHVEMKIAADEEENADNTMGSNPANVT
KPRRLNSSICYGVIAIIIFFLIGFMIGYLGYCKRAEPKAGCEGESATAPSATEDPEAPEA
DEFPEAPSYLFWGDLKKILSQKLNTAEFASTIKRLSESPYVPREAGSEKDENLGYFIENR
FREFKLSKVWRDEHYVKTQVKGSVENSVSIVAGNGTIVSLVEHPKGYVAYSKPATVTGKL
VHANFGTITDFENLNSPVDGSLVIVRAGKITFAEKTANAESFNATGVLIYMDQADFPVVE
ADLPVFGHAHLGTGDPYTPGFPSFNHTQFPPAQSSGLPNIPVQTISRSGAEQLFDPKNME
QLCPGTWKTKSLCKMRSVEGRNVKLTVNNVLKEARILNIFGVIKGFEEPDRYVVVGAQRD
AWGTGAAKSGVGTALLLELARIFSDMVLKDGFKPSRSIVFASWSAGEFGAVGATEWLEGY
LSTLHLKAFTYINLDKAVLGTSNFKVSASPLLYLLIEKTMQDVKHPISGQSLYQDSNWAN
KVEKLSYDDAAFPFLAYSGIPALSFCFCEDNDYPYLGTQKDTYEVLVERIPQLDKMARTA
AEVAGQLVIRLTLGLELDLDYERYNDKMLSFLKDINQFRTDVKEMGLNLQWLYSARGDFF
RATSRLTTDFKNAERTNKIIMREMNDRIMKVEYHFLSPYVSPKDYPFRHIFWGSGSHTLS
ALLENLELRQKNRAAFNETLLRNQLALTTWTIQGAANALTGDIWDIDNEF
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgatgaatcaagccagatcggcattctctaacttgttcagtggacaatcattgtcgtat
acccgatttagtctggcccggcaagtagatggcagcaacagtcatgtggagatgaaaata
gctgcagatgaagaagaaaatgctgacaataccatggggagtaaccctgccaacgtcaca
aaaccaaggaggcttaatagcagtatctgctatggtgttattgctataatcatctttttc
ttgattggatttatgattggctacttgggctattgtaagcgagcagaaccaaaagctggg
tgtgagggagagtcagcaacagcgccttcagcgacagaggacccagaagctcctgaggca
gatgaatttcctgaggcaccttcttacttattttggggagacctcaaaaaaattttgtca
cagaaactgaataccgcagagtttgccagcaccatcaagcggctgagtgaaagtccctat
gtcccccgtgaggctggatctgaaaaagatgaaaaccttggatattttattgaaaatcga
ttccgtgaatttaaactcagtaaagtctggcgtgacgaacattatgttaagactcaggtc
aaaggcagtgttgaaaactcagtgagcatagtagctgggaacgggaccattgtatccttg
gtggagcatcctaagggttacgtggcgtatagtaagcctgcaacagttactggtaaactg
gtgcatgctaattttggcactataacagacttcgagaatttaaactctcctgtggatgga
tctttagtgattgttagagcagggaaaattacttttgctgaaaagactgcaaatgctgaa
agctttaatgcaactggtgtcttgatatacatggaccaagctgacttccccgttgttgag
gcagatctcccagtctttggacatgctcatctgggaacaggtgatccttatacacctgga
ttcccctccttcaatcacactcagtttccaccagctcagtcatcaggattgcctaatata
cctgtacaaacaatttccagatctggggcagaacagctgtttgatcctaaaaatatggaa
cagctctgtcctggtacttggaaaacaaagtctttatgtaagatgcggtccgtagaaggt
aggaacgtgaaactcactgtcaacaatgtgctgaaagaggcaagaattctgaacatcttt
ggcgttatcaaaggctttgaggaaccagaccgctatgttgtagtcggagcacagagggat
gcctggggtaccggagcggcaaagtccggtgtaggaacagctcttctcttagaacttgca
cggatattctcagatatggtcttgaaagatggatttaaacccagcagaagtatcgtcttt
gccagctggagtgctggagagtttggagctgttggtgccactgaatggctagagggatac
ctttcaaccttgcatctgaaggcgtttacttacattaatctggataaagctgttcttggt
accagcaacttcaaggtctctgccagcccactgttgtatttgcttattgagaaaacgatg
caagatgtgaaacatccaattagtggtcagtctctctatcaggacagcaactgggcgaac
aaagttgagaagctttcttatgatgatgctgctttccctttccttgcatattctggaatt
ccagcactttctttttgtttttgtgaggacaacgattatccttatttgggtacccaaaag
gacacctatgaggtactggttgagagaatccctcagctggacaaaatggcacgtacagca
gcagaggtggctggtcagcttgtgattagacttacccttggccttgaattggacctcgac
tatgagaggtataacgacaaaatgctttcattcctgaaggatataaaccaattcaggaca
gacgtaaaggaaatgggtctgaacctacagtggctgtattctgcgcgtggggacttcttc
cgtgctacttccaggctcacgacagatttcaagaatgctgagagaacaaacaagattatc
atgagggaaatgaatgatcgtatcatgaaagtggagtatcacttcctctcaccctacgtg
tctccaaaggattatcccttccgacatatcttctggggctctggctctcacactctgtcg
gctttactggagaacttggagctgcgtcagaaaaacagggctgcttttaacgaaacgctg
ttgcgaaaccagctggccctcactacttggactattcagggtgccgcaaatgctctgact
ggggacatctgggacattgacaatgagttttag

DBGET integrated database retrieval system