KEGG   Loxodonta africana (African savanna elephant): 100667310
Entry
100667310         CDS       T04351                                 

Gene name
COP1
Definition
(RefSeq) E3 ubiquitin-protein ligase RFWD2 isoform X1
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
lav04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100667310 (COP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100667310 (COP1)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100667310 (COP1)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100667310 (COP1)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100667310 (COP1)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 zf_C2H2_10 zf-RING_10 zf-RING_11 Prok-RING_4 zf-RING_4 DZR zf-Nse
Other DBs
NCBI-GeneID: 100667310
NCBI-ProteinID: XP_010589292
LinkDB
Position
Unknown
AA seq 731 aa
MSGSRPAGSGSAGKSPGSSAASSLTSASSSLSSSPSPPSVAASAAALVSGGAAQAAGSGG
LGGPVRPVLVAAAASGSGGGAVSVGPSRLSCAARPSPGVGGSSSSLGSGSRKRPLPTPLC
NGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNI
DHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQMLQDVLGTDQDNLDLANVNF
MLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMS
GLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRL
TAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSRFTRYNSVRPLATLSYASDLYNG
SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSS
YHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKL
WSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRK
AVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSE
NNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAAN
SQGTIKVLELV
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgtcaggtagccgcccggccggatcgggctccgctgggaagagccctggctcctcggcg
gcctcctcgttgacttccgcctcctcgtccttatcctcttccccgtcgcccccttccgtg
gcggcttcggcggcggcgctggtgtccggcggagcggcccaggccgcgggctcgggcggc
ctcgggggcccggtgcggcctgtgctggtggcggccgcggcgtcgggcagcggcggcggg
gcggtgtccgtgggcccgtcccggctcagctgcgcggccaggcccagccccggcgtaggt
gggagcagctccagcctaggcagcggcagcaggaagcgacctctgcccaccccgctctgc
aacgggctcatcaactcctatgaagacaaaagcaacgacttcgtctgccccatttgcttt
gatatgatcgaagaagcatacatgacgaaatgtggccacagcttttgctacaagtgtatt
catcaaagtttggaggacaataatagatgtcccaagtgtaactatgttgtggacaacatt
gaccatctgtatcctaatttcttggtgaatgagctcattctcaaacagaagcaaagattt
gaggaaaagaggttcaaattggaccactcagtgagtagcaccaatggccacagatggcaa
atgcttcaggatgtcttgggaactgaccaagataaccttgatttggctaatgtcaacttc
atgctggagttactagtgcagaagaagaaacaattggaagcagaatcacatgcagcccaa
ctacagatccttatggaattcctcaaggttgcaagaagaaataagagagagcaactggaa
cagatccagaaggagttaagtgtcctggaagaggatattaaaagagtggaagaaatgagc
ggtttatactctcctgtcagtgaggatagcacagtgcctcaatttgaagctccctctcca
tcacacagtagtattattgattccacagagtacagccaacctccaggtttcagtggcagt
tctcagacaaagaaacagccttggtataacagcacattagcatcaagacgaaaacgactc
actgctcactttgaagacttggagcaatgctacttttctacaaggatgtctcgtatttca
gatgatagtcgaactgcaagccagttggatgaatttcaggaatgtttgtccaggtttact
cgatataattcagtacgacctttggccacattgtcatacgctagtgatctttacaatggt
tccagcattgtctctagtattgaatttgaccgggattgtgactattttgctattgctggg
gttacaaagaagattaaagtctatgaatatgacacagtcatccaggatgcagtggatatt
cattaccctgagaatgaaatgacctgcaattccaaaatcagctgtatcagttggagtagt
tatcataagaacttgttagctagcagtgattatgaaggcactgtcatcctatgggatgga
ttcacagggcagaggtcaaaggtctatcaggagcatgagaagaggtgttggagtgttgac
tttaatttgatggatcctaaactcttggcttcaggttctgatgatgcaaaagtgaagctg
tggtctaccaacctagacaactccgttgcgagcattgaggccaaggctaacgtgtgctgt
gtcaaattcagcccctcttctagataccatttggctttcggctgtgcagatcactgtgtc
cactactatgatcttcgtaacactaaacagccaatcatggtattcaaaggacaccgaaaa
gcagtctcctatgcaaagtttgtgagtggtgaggaaattgtctctgcatcaacagacagt
cagctaaagctgtggaatgttgggaaaccatattgcctacgttccttcaagggtcatatc
aatgaaaaaaactttgtaggcctggcatccaatggagattatatagcttgtggaagtgag
aacaactctctctacctgtactataaaggactttctaagacattgttaacttttaagttt
gacacggtcaaaagtgtcctggacaaagaccgaaaagaagacgatacaaatgaatttgtt
agtgctgtatgctggagggcactgccagatggggagtccaatgtgctgattgctgctaac
agtcagggtacaattaaggtgctggagttggtttga

DBGET integrated database retrieval system