KEGG   Loxodonta africana (African savanna elephant): 100667505
Entry
100667505         CDS       T04351                                 

Gene name
PTK2B
Definition
(RefSeq) protein-tyrosine kinase 2-beta isoform X1
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04062  Chemokine signaling pathway
lav04072  Phospholipase D signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04670  Leukocyte transendothelial migration
lav04912  GnRH signaling pathway
lav05135  Yersinia infection
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100667505 (PTK2B)
   04072 Phospholipase D signaling pathway
    100667505 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100667505 (PTK2B)
   04670 Leukocyte transendothelial migration
    100667505 (PTK2B)
   04062 Chemokine signaling pathway
    100667505 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100667505 (PTK2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100667505 (PTK2B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100667505 (PTK2B)
   05161 Hepatitis B
    100667505 (PTK2B)
   05163 Human cytomegalovirus infection
    100667505 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100667505 (PTK2B)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100667505 (PTK2B)
Protein kinases [BR:lav01001]
 Non-receptor tyrosine kinases
  FAK family
   100667505 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 100667505
NCBI-ProteinID: XP_003412508
LinkDB
Position
Unknown
AA seq 1009 aa
MSGVSEPLSRVKVGTLRRPEGPPEPMVVVPIDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTIQTEIQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYER
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPRQMQENLKPKQFRKMIQQTFQQYAS
LKEEECIMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQVRSIRCLPLEEGQAVLQLGIEGAPQSLSIKTSSLAEAENMADLVDGYCRLQGEHKG
SLIVHPRKDGEKRNSLPQIPVLNLEDRRSHFSESCSIESDIYAEIPDETLRRPGGPQYGV
TRENVILGRILGEGFFGEVYEGVYQNHKGEQINVAIKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPIWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEEYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIEVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMEKDIAIEQERNARYRAPKILEPTAFQDPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDLIRPSSREEAQQLWEAERVKMRQMLDKQQKQMAEDYKWLRQEERSLDPMVYMNDKSP
LSPEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLDLKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPPSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtctggggtgtccgagcccctgagccgagtgaaggtgggcacgttgcgccggcctgaa
ggccccccagagcccatggtggtggtgcccatagatgtggaaaaggaagatgtgcggatc
ctcaaggtctgcttctatagtaacagcttcaaccccgggaagaacttcaaactggtcaaa
tgcaccatacagacggagatccaggagatcatcacctccatcctgctgagtgggcgaatt
gggcccaacatccagctggctgagtgctatgggctgaggctgaaacacatgaagtcagat
gagatccactggttgcatccgcagatgacggtgggtgaggtgcaggacaagtacgagcgt
ctacacgtggaggccgagtggaggtatgaccttcaaatccgctacttgccagaggacttc
atggagagcctgaaagaagacaggacaacgctgctttatttttaccaacagctcaggaat
gactacatgcaacgctacgccagcaaggtcagcgagggcatggctctgcagctgggctgt
ctggagctcaggcgattcttcaaggatatgccccacaatgcacttgataaaaagtccaac
tttgagctcctggagaaggaagtggggctggacctatttttcccaaggcagatgcaggag
aacttaaagcctaaacagttccggaagatgatccagcagacgttccagcagtatgcgtcg
ctgaaggaggaggagtgcatcatgaagttcttcaataccctcgcaggctttgccaacatc
gaccaggagacctaccgctgtgaactcattcaaggatggaatattactgtggacctggtc
attggacctaaaggcatccgccagttgacaagtcaagatgcaaagcccacctgcctggct
gagttcaagcaggtcaggtccatccggtgcctcccgctggaggagggacaggccgtgctg
cagctgggcattgaaggcgccccccagtccttgtccatcaaaacctcctctctggcagaa
gctgagaacatggctgaccttgtcgatggttactgccggttgcagggggagcacaaaggc
tctctcatcgttcaccccaggaaagatggtgagaagcggaacagcctgccccagatccct
gtgctaaacctggaggatcgacgatctcacttctcagaaagctgcagcatagagtcagac
atctatgcagagatccctgatgagaccttgagaaggcctggaggtccacagtatggcgtc
acccgggaaaatgtgattctgggtcgcattcttggcgaaggcttttttggggaggtatac
gaaggtgtctaccagaaccataagggggagcaaatcaatgtcgctataaagacctgcaag
aaagattgcactctggacaacaaggagaagttcatgagtgaggcagtgatcatgaagaat
ctcgaccacccacacatcgtgaagctgatcggcatcattgaggaggagcccatctggatc
atcatggaattgtatccctatggagagctgggccactacctggagagaaacaagaactcc
ctgaaggtgctcacccttgtcctgtactcgctgcagatatgcaaggccatggcctacctg
gaaagcatcaactgtgtccacagggacatcgctgtccgaaatatcctggtggcctcgcct
gagtgtgtaaagctgggagactttggcctttcccggtacattgaggatgaggagtattat
aaagcttctgtgactcgtcttcccatcaagtggatgtctcctgagtccattaacttccgc
cgcttcacgacagccagtgacgtctggatgtttgctgtgtgcatgtgggagatcctgagc
ttcgggaagcagcctttcttctggctggaaaacaaggatgtcattgaagtgctggagaaa
ggggaccggctgcccaaacctgacctctgcccacctgtcctttacacactcatgacccgc
tgctgggactatgaccccagtgaccggcctcgcttcactgagcttgtgtgtagcctcagt
gacatttaccagatggagaaggacattgctatagagcaggagagaaatgctcgctaccga
gcccccaaaatcttggagcccacagccttccaggaccccccacccaagcccagccggccc
aagtacagaccccctccacaaaccaaccttctggctcccaaactgcaattccaggtaccc
gagggtctgtgtgccagctcacctacgctcaccagccctatggagtatccatctcctgta
aactcgctgcacaccccacctcttcaccggcacaatgtcttcaagcgccacagcatgcgg
gaggaggacctcatccgacccagcagccgcgaagaggcccagcagctatgggaggccgag
agggtcaagatgcggcagatgctggacaagcagcagaagcagatggcggaagattacaag
tggctgaggcaggaggagagatccctggaccccatggtttacatgaatgataagtcccca
ctgagcccagagaaggaggctggctacacggagttcacagggcctccacagaagccaccg
cggctaggcgcacagtccatccagcccacagctaacctggacaggactgatgacctggtg
tacctcaacgtcatggagctggtgcgagctgtgctagacctcaagaacgagctctgtcag
ctgcctcccgagggctatgtggtcgtggtgaagaatgttgggctcacgctgcggaagctc
atcgggagtgtggacgatctcctgccttccttgccaccatcttcacgaacagagattgag
gggacccagaaactgctgaacaaggacctcgcagagctcatcaacaagatgcggctggcc
cagcagaacgcagtgacctccctgagtgaggagtgtaagcggcagatgctcacagcctcc
cacaccctggctgtggatgccaagaacctgctcgatgctgtggaccaggccaaggttctg
gccaacctggctcacccacctgcagagtga

DBGET integrated database retrieval system