KEGG   Loxodonta africana (African savanna elephant): 100667513
Entry
100667513         CDS       T04351                                 

Gene name
PDX1
Definition
(RefSeq) LOW QUALITY PROTEIN: pancreas/duodenum homeobox protein 1
  KO
K07594  insulin promoter factor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04911  Insulin secretion
lav04930  Type II diabetes mellitus
lav04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100667513 (PDX1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100667513 (PDX1)
   04950 Maturity onset diabetes of the young
    100667513 (PDX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100667513 (PDX1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    100667513 (PDX1)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 100667513
NCBI-ProteinID: XP_010592327
LinkDB
Position
Unknown
AA seq 196 aa
MQPPGGTYATEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIK
IWFXNRRMKWKKEEDKKRAAGRRXRGSGGAEPEQDCAVTSGXELLALPPHPPPXGAVPPT
APAASERRLLPAERVTQPRQPRVFWVRGKEVWAFGASDADAGGHPGFFPAPPGREPQPDC
APEGASGEPPSPRAID
NT seq 591 nt   +upstreamnt  +downstreamnt
atgcagcctccgggcggcacctacgcgacggagccggaggagaacaagcggacacgcacg
gcttacacgcgcgcgcagctgctggagctggagaaggagtttctattcaacaagtacatc
tcgcgaccgcgccgggtggagctggctgtcatgctgaacttgaccgagagacacatcaaa
atctggttcncaaaccgccgcatgaagtggaaaaaggaggaggacaagaaacgtgcagcg
gggcggcgannccggggcagcgggggcgcagagccggagcaggactgtgcggtgacctcg
ggcngagagctgctggcgctgccgccgcacccgccccccnggggcgccgtgcctcccact
gcccctgccgcttccgagagacgtctgctcccggctgagcgcgtcacgcagcctcgacag
ccaagagtgttctgggttaggggcaaagaggtctgggcttttggggcttccgacgccgac
gccgggggccaccctggctttttcccggcgcctcctggccgggagccccagccggattgt
gcacctgaaggcgcctcgggagagcccccatcgccccgggccattgactag

DBGET integrated database retrieval system