KEGG   Loxodonta africana (African savanna elephant): 100667571
Entry
100667571         CDS       T04351                                 

Gene name
IRF3
Definition
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav05133  Pertussis
lav05135  Yersinia infection
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100667571 (IRF3)
   04621 NOD-like receptor signaling pathway
    100667571 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    100667571 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    100667571 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100667571 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100667571 (IRF3)
   05133 Pertussis
    100667571 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100667571 (IRF3)
   05161 Hepatitis B
    100667571 (IRF3)
   05160 Hepatitis C
    100667571 (IRF3)
   05171 Coronavirus disease - COVID-19
    100667571 (IRF3)
   05164 Influenza A
    100667571 (IRF3)
   05162 Measles
    100667571 (IRF3)
   05168 Herpes simplex virus 1 infection
    100667571 (IRF3)
   05163 Human cytomegalovirus infection
    100667571 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100667571 (IRF3)
   05169 Epstein-Barr virus infection
    100667571 (IRF3)
   05165 Human papillomavirus infection
    100667571 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100667571 (IRF3)
   04131 Membrane trafficking [BR:lav04131]
    100667571 (IRF3)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100667571 (IRF3)
Membrane trafficking [BR:lav04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100667571 (IRF3)
SSDB
Motif
Pfam: IRF-3 HVSL
Other DBs
NCBI-GeneID: 100667571
NCBI-ProteinID: XP_023398997
LinkDB
Position
Unknown
AA seq 275 aa
MVLASVPDGGPSGLAVASEQPPQLLLSPNIDVLPPCPNLASSENPLRQLLVPEEEWEFEV
TAFYRGRQVFQQAVFCPGGLRLVGSEAADNTLPGQLMMLPDPGVALTDKGATSFVRRVLS
SLGGGLALWRAGQQLWARRLGHCRTYWAAGEELLPDGTHGPDGEVPKDREGVVFNLGPFV
ADLIAFIEGSKRSPRYTLWFCIGELWPQDQPWTKKLVMVKVVPTCLRVLLDMARVEGASS
LETTMDLHISNSHPLSLTSDQYKAYLQDLAEDMDF
NT seq 828 nt   +upstreamnt  +downstreamnt
atggtcttggcctcagtcccagatggggggccctcaggactggctgtggcctctgagcag
ccccctcagctcttgctgagccccaacattgacgttcttcctccctgcccaaacctggca
tcctcggaaaacccactgaggcagctgctggtccccgaggaagagtgggagtttgaggtg
accgccttctaccggggccgccaagtcttccagcaggctgtcttctgcccaggtggcctg
cggctggtgggatcagaagcagcagacaatacactgcctgggcagctgatgatgctgcct
gaccctggggtggccctgacagacaagggggcgacaagcttcgtgaggcgtgtgctgagc
tccctaggcggggggcttgctctgtggagggcagggcaacagctctgggcccgaaggctg
gggcactgccgtacatactgggctgcgggtgaggagctgctccctgatggcactcacggg
ccagacggagaggtccccaaagacagagaaggagtcgtgttcaacctgggaccttttgtg
gcagatctgattgccttcatcgaaggaagcaaacgctcaccccgctacaccctctggttc
tgcattggggagttatggccccaggaccagccgtggaccaagaagctggtgatggtcaag
gtagttcccacatgcctccgggtcctgctagacatggcccgggtggagggtgcctcctca
ctggagactaccatggacctgcacatttctaacagccacccgctctccctcacctcagac
cagtacaaggcctatctgcaggacctggccgaggacatggatttctaa

DBGET integrated database retrieval system