KEGG   Loxodonta africana (African savanna elephant): 100667586
Entry
100667586         CDS       T04351                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100667586 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    100667586 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100667586 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100667586 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100667586 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    100667586 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    100667586 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100667586 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100667586 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100667586 (IFNAR1)
   05160 Hepatitis C
    100667586 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    100667586 (IFNAR1)
   05164 Influenza A
    100667586 (IFNAR1)
   05162 Measles
    100667586 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    100667586 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100667586 (IFNAR1)
   05169 Epstein-Barr virus infection
    100667586 (IFNAR1)
   05165 Human papillomavirus infection
    100667586 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lav04050]
    100667586 (IFNAR1)
Cytokine receptors [BR:lav04050]
 Interleukin receptor families
  IFN receptor family
   100667586 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 100667586
NCBI-ProteinID: XP_003410200
LinkDB
Position
Unknown
AA seq 560 aa
MLALLGTAALVLVAGAPWVSPAAAGGKNLTSPQNVEVCIIDDAFTLKWDRSDESVSNVTF
SADYQTPKMRNWEKLPGCQYITGTMCNFSSVKLNVFEKIKLRVRAEKGNETSPWHEVGSF
VPYRKAQIGPPEARLKAEDKAIIVDISPPGTKDSLMWATDRSAFTYRLVIWENSASVDER
TETVYPGGKIYKLSPETTYCLKVKAELRLQRRVGSYSPVYCINTTVENKLPPPENIEVDA
KNQSYVLKWDYTYENVTFQAQWLYAYFKKILGNHSDKWKQIPGCRNVKTTQCVFPQKVFP
EGTYLLRVQASNGNKTSFWSEEKALDTEIKTAILPPVISMKSISNSLQIYIGAPKDTENK
SVSQAYVLTYEIIFWKNTSNAERKILQKKGDFVIPDLHPLTVYCVKARALVEGERWNKSS
VFSDTVCEKTKPGNTSIAWLISGVCTVVFFIPAVIYVVKHLLGYIKYVFFPSCKPPPSID
QYFSEQSLKNLLLSTSEEQTERCFIIENTDALVTVEETNQVGEDHKKYSSQTSRDSGNYS
NEDENSGGKTSEELVQQEIL
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgctcgccctcctgggcacagcggccctggtgctggtcgccggggcgccctgggtgtct
cccgcagccgcaggtggaaaaaacctcacatctcctcaaaacgtagaggtctgcatcata
gatgacgcctttaccctgaagtgggacaggagtgacgagtctgtcagcaacgtgactttt
tcagcagattaccaaacacctaaaatgcgtaactgggaaaaactgcctgggtgtcaatat
attactggtaccatgtgcaacttttcttcagtcaagctaaacgtgtttgaaaaaattaag
ttacgtgtaagagcagaaaaaggaaacgaaacttctccatggcatgaggttggctcattt
gtcccctatcgaaaagctcagattggccctccggaagcgcgtttaaaagctgaagataag
gccataatagtcgacatctctcctcctgggacaaaagacagtctcatgtgggctacggat
cggtcagcctttacgtaccgcttggtgatctgggagaactcagccagtgtagacgaaagg
actgagactgtttatcctggaggtaaaatttataaactctccccagagactacttactgt
ttaaaagtgaaggcagaactacgtttgcagagaagagttggttcctatagtccagtgtat
tgtataaacaccacagttgaaaataaactgcctccaccagaaaatatagaagtcgatgct
aaaaatcagagctatgttcttaaatgggattacacgtatgaaaacgtaacctttcaagct
cagtggctctatgcctattttaaaaagattcttgggaaccattcagataaatggaaacaa
atacctggctgtagaaatgtcaaaactacccagtgtgtatttcctcaaaaagttttccca
gaaggaacttaccttctccgtgtacaagcctctaatggaaataaaacatctttttggtct
gaagagaaagcacttgatactgaaattaaaactgccatacttcctccagtcattagtatg
aaatccattagtaattcactgcagatctacattggcgctccaaaggacactgaaaacaag
tctgtgagccaggcttatgtacttacttatgaaattattttttggaaaaacacttcaaat
gctgagcgcaaaatcctgcagaaaaaaggtgattttgttattcccgatttgcacccgttg
actgtatattgtgtcaaagcccgagcactcgtggagggtgaacgatggaataaaagcagt
gtttttagtgataccgtgtgtgagaaaacaaaaccagggaatacatccatagcctggctt
atatctggagtttgcactgtggtgttcttcatcccggctgtcatttatgttgtgaaacac
ctcttgggatatatcaaatatgtattctttccatcatgtaagcctcctcccagtatagac
cagtatttctctgaacagtcactaaagaatctactcctttccacttctgaggaacaaact
gaaagatgttttatcattgaaaatacggacgctcttgtcacagtagaagaaactaaccaa
gttggtgaagatcacaaaaaatacagctcccagactagccgagattcaggaaactattct
aatgaggatgaaaacagcggaggtaaaacaagtgaagaacttgtacaacaggaaatcttg
tga

KEGG   Loxodonta africana (African savanna elephant): 100672898
Entry
100672898         CDS       T04351                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha/beta receptor 2 isoform X2
  KO
K05131  interferon receptor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav05160  Hepatitis C
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100672898 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    100672898 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100672898 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100672898 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100672898 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    100672898 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    100672898 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100672898 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100672898 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100672898 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    100672898 (IFNAR2)
   05164 Influenza A
    100672898 (IFNAR2)
   05162 Measles
    100672898 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    100672898 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100672898 (IFNAR2)
   05169 Epstein-Barr virus infection
    100672898 (IFNAR2)
   05165 Human papillomavirus infection
    100672898 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lav04050]
    100672898 (IFNAR2)
Cytokine receptors [BR:lav04050]
 Interleukin receptor families
  IFN receptor family
   100672898 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100672898
NCBI-ProteinID: XP_003410349
LinkDB
Position
Unknown
AA seq 515 aa
MVLSQNASVIRPLNLYPWVYISLVFVTSHALPDFLEKPCTLKITLRNFQSIFSWELKNHS
IVPTHYTLWYTIMSKPEGMKMVEGCTNITRPFCDLTDLWNNMHETYIPRVVAFKGNTELV
SCVDSIFLPLNMSFDPPDFEIVDSMGHINVIVKFPYNAPKISVDRLRRHLSLVIEQRSEE
IVKKHKPKITGNVTGDFVYVLDKLIPNTNYCVSVYFEPKNLRAVIRSPLKCTLLPGLEPE
SSESAIIGGIVTVFLIATVFISSIVTLKRIGYIYLRYNLPDALNFYNRPAWIFPEPPPLE
AVDTVDVIYINRKKKVRDYNSDDETDSEDETAPRVSAGGYTRHGLITKLLTQASTSLSTS
KESQLIDLDVGEDYLSEAEAEPPLVPEPSSGQSECASGPYDRRESELQDPFSEEDNSSTE
GSGDRIIFNVNLNSVFVRALDNDDDGDVSPMLPEETVDLENPDEMESSFLIPREEGMPPP
FPSTSEEHLESEDAPSEKSDSSESDVDIGDGYVMR
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggttttaagccagaatgcctctgtgatcagacctcttaacttatatccctgggtgtac
atcagccttgtgttcgtcacttcacatgctttgcctgattttttagagaaaccttgcact
ttaaagataacgctacgaaacttccagtcaatcttctcatgggaattaaaaaaccattcc
attgtaccaacacactatacattatggtacacgatcatgagtaaaccagaaggcatgaag
atggttgaaggctgtacaaatattacgagaccgttttgtgacctaacagatttatggaac
aacatgcatgagacctacatcccaagagtcgtggcattcaaagggaacacagagctggtc
agctgtgtggacagtatcttcctgcccttaaacatgagttttgaccctccggactttgag
attgttgactctatgggccacattaatgtgatagtgaaattcccatacaacgctcccaag
ataagtgtggacaggctgcggcgtcatttgtccctcgtcattgaacagcgatcagaggag
atagtgaagaagcataaacccaaaataactggaaacgtcactggagatttcgtttatgtc
ctggacaagttgattccaaacacaaactactgtgtgtctgtctattttgaacctaaaaat
ctgcgagcagtaatcagatcccccctaaaatgtaccctccttccaggcctggaaccagag
tcatcggaatctgccataataggaggaatagtcactgtgtttttaatagcaactgtcttc
ataagcagcatagtaacactgaagcggattggttatatatacctaagatataacctcccc
gatgcattgaatttttataacaggccagcctggatctttccggagccgccaccattggaa
gcagtggatacagtggatgtcatttatatcaaccgaaagaagaaagtgcgggactacaat
tctgatgatgagactgacagcgaggatgagaccgctcctagagtgagcgctggcggttac
accaggcatgggctaatcaccaagctcctgactcaggcttccacctccttgtccacctcc
aaggagtcacagctcatagacctagatgtgggtgaagattacctgtcagaggctgaggct
gagcccccactggtgccagagcctagctccgggcagtcagaatgtgcaagtggaccctat
gacaggagagagagtgagctccaggaccccttttccgaggaggacaacagctccaccgag
ggctctggggacaggataatctttaatgtgaatttaaactctgtgtttgtgagggccctc
gacaacgacgatgatggagatgtctcaccgatgcttccagaagagacagttgacctagag
aaccctgatgagatggaatcaagctttctgatccccagggaggaggggatgccgccgccc
ttccccagcacctccgaggagcacttggagtccgaagatgctccttccgagaaaagcgac
tcttctgagtcagatgttgacattggggacggttatgtaatgagatga

DBGET integrated database retrieval system