KEGG   Loxodonta africana (African savanna elephant): 100667678Help
Entry
100667678         CDS       T04351                                 

Gene name
GAD2
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00250  Alanine, aspartate and glutamate metabolism
lav00410  beta-Alanine metabolism
lav00430  Taurine and hypotaurine metabolism
lav00650  Butanoate metabolism
lav01100  Metabolic pathways
lav04727  GABAergic synapse
lav04940  Type I diabetes mellitus
Module
lav_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100667678 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100667678 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100667678 (GAD2)
   00430 Taurine and hypotaurine metabolism
    100667678 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100667678 (GAD2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100667678 (GAD2)
Enzymes [BR:lav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100667678 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 100667678
NCBI-ProteinID: XP_010588972
LinkDB All DBs
Position
Unknown
AA seq 588 aa AA seqDB search
MASPGSGFWSFGSEDGSGDPENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESDG
REPXRAIPRKGVWARDQEAPAVAPRGEVNYAFMHATDKDLLPACNGERPTLAFLQDVMDI
LLQYVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILTNCRTTLKYAIKTGHPR
YFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWSGGSGDG
IFSPGGAISNMYAMLIARFKAFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTD
SVILIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAIADICKKY
NIWMHVDAAWGGGLLVSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQR
CNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAQIDKCLEL
AEYLYNIIKNREGYEMVFDGKPQHTNVCFWYVPPSLRTLEDNEERMSRLSKVAPVIKARM
MEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcctggctccggcttttggtccttcgggtccgaagatggctctggggatccc
gagaaccctggcacagcgagagcctggtgccaggtggcccagaagttcaccggcggcatc
ggaaacaagctgtgcgccctgctctacggagacgcagagaagcccgcggagagcgatggc
agggaaccctagcgggccatccctcggaaaggcgtctgggcccgtgaccaagaagccccg
gcagttgccccaaggggggaagtcaactatgcgtttatgcacgcaacagataaagacttg
ctgccagcttgcaatggagaaaggcccactttggcgtttctgcaagatgttatggacatt
ttgcttcagtatgtggtgaaaagtttcgatagatcaaccaaagtcattgatttccattac
cctaatgagcttcttcaagagtataattgggaattagcagaccagccacaaaatttggag
gaaattttgacgaattgccgaacaactctaaaatatgcaattaaaacagggcatcccaga
tatttcaatcaactttccactggattggatatggttggattagcagccgattggctgaca
tcaacagcaaatactaatatgtttacctatgaaattgctccagtatttgtgcttttggaa
tatgtcacactaaagaaaatgagagagatcatcggctggtcagggggctccggcgacggg
atattttctcctggtggagccatatctaacatgtacgccatgctgattgcgcgcttcaag
gcattcccagaagtcaaggagaaaggaatggccgccgttcccaggctcattgccttcaca
tccgaacatagtcatttttcgcttaagaagggagctgcagccttggggattggaacagac
agcgtgattctgattaaatgtgatgagagagggaaaatgatcccatctgatcttgaaaga
aggatccttgaagccaaacaaaaaggatttgttcctttccttgtgagcgccactgctgga
accaccgtgtatggagcgttcgatcccctcttagctattgctgacatttgcaaaaaatat
aacatctggatgcatgtggatgcagcttggggaggaggattactggtatcccggaaacac
aaatggaaattgagcggcgtggagagggccaactctgtgacatggaatccacacaagatg
atgggtgtccctttgcagtgttcagctctcctggttagagaagagggattgatgcagagg
tgcaaccagatgcatgcctcctacctctttcagcaagataaacactacgacctgtcctat
gacactggagacaaagccctacagtgcgggcgccatgtcgatgtttttaagttgtggcta
atgtggagggcaaagggaactactgggtttgaagcacagattgacaagtgtttggagctg
gcggagtatttatacaatatcataaaaaaccgagaaggatatgaaatggtgtttgatgga
aagcctcagcacaccaatgtctgcttctggtatgtacctccgagcttgcgtactctggaa
gacaatgaagaaagaatgagtcgcctctcaaaggtggctccagtgattaaagccagaatg
atggaatacgggaccacaatggtcagctaccagcccttgggagacaaggtcaacttcttc
cgcatggtcatctcaaaccccgcagcaactcatcaagacattgacttcctgattgaagaa
atagaacgccttggacaagatttataa

DBGET integrated database retrieval system