KEGG   Loxodonta africana (African savanna elephant): 100667696Help
Entry
100667696         CDS       T04351                                 

Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04614  Renin-angiotensin system
lav04924  Renin secretion
lav05142  Chagas disease (American trypanosomiasis)
lav05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100667696
   04614 Renin-angiotensin system
    100667696
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100667696
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100667696
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lav01002]
    100667696
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100667696
   04090 CD Molecules [BR:lav04090]
    100667696
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100667696
Peptidases [BR:lav01002]
 Metallo Peptidases
  Family M2
   100667696
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100667696
CD molecules [BR:lav04090]
 Proteins
  100667696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100667696
NCBI-ProteinID: XP_003414368
LinkDB All DBs
Position
Unknown
AA seq 1314 aa AA seqDB search
MGAVPGSPGPPPLLPLLLLLLRPPPATLALDPALQPGNFSTDEAGAQLFAQSFNSSAEQV
RFLNTVANWAYDTNITEENAQRQEETALISQDFDEAWGYKAKELYDNIWQNFTNPQLRRV
IRSIRILGPANLALAKRQQYNSLLSNMSRIYSTSKVCFPNKTATCWSLDPELTNILASSR
SYTMLLFAWEGWHDAVGIPLKPLYQDFTALSNEAYKQDGFSDTGDYWRSWYESPTFVEDL
EYLYHQLEPLYLNLHAYVRRALHRRYGDKFINLRGPIPAHLLGNMWAQSWENIYDMVVPF
PDKPNLDVTSTMVQKGWNTTHMFRVAEEFFTSLGLLPMPPEFWAHSMLEKPSDGREVVCH
ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDQPVSLREGANPGFHEAI
GDVLALSVSTPAHLHKIGLLDQVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS
GRTPPSLYNFDWWYLRTKYQGICPPVVRNETHFDAGAKFHVPNMTPYIRYFVSFVLQFQF
HQALCKEAAHQGPLYQCDIYQSTQAGNKLRELLQAGSSRPWQELLKDMIGSDALDAQPLL
NYFQPVSQWLQEQNQRNGEVLGWPEYQWRPPLPDNYPEGIDLVTDEAEAQKFVEEYDKTA
QVVWNEYAEANWNYNTNITQEASKILLQKNMQLANHTLRYGTQAKQFDVTNFQNETTKRI
MKKVQDLDRAVLPTEELEQYNQILLDMETTYSMASVCHLNGTCLQLEPDLTKLLATSRNY
EELLWAWEAWRDKVGRAILPFFPKYVELSNKAAKLNGYKDTGDSWRAMYETPLLEHDLEL
LFQELQPLYLNLHAYVRRALHRHYGPERINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS
APKMDATEAMIKQGWTPKRMFEEADNFFTSLGLLPVPPLFWNKSMLEKPTDGREVVCHAS
AWDFYNGKDFRIKQCTTVDMEDLVVAHHEMGHIQYFMQYKDLPLALREGANPGFHEAIGD
VLALSVSTPQHLYSINLLSSEGGGYEHDINFLMKMALDKVTFIPFSYLVDQWRWRVFDGS
INKENYNQEWWSLRLKYQGLCPPVSRSQGDFDPGAKFHIPSSVPYIRYFVSFVIQFQFHE
ALCQAAGHQGPLYKCDIYQSKEAGKRLADAMKLGFSKPWPEAMRLITGQPNMSATAMMNY
FKPLLXXXXXXXGREAKLAAPSPAYRPAHHPTLLASRPAHSEASFTGSGRVNFLGLELEA
HQARVGQWVLLFLGVALLVATLGLTQRLFSIRHQSLRHPHRGPQFGSEVELRHS
NT seq 3945 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgttccgggtagcccagggccgccgccgctcctgccgctgctgctgctgctg
ctgcggccgccgccggccactctggcgctcgaccccgcgctgcagccgggaaacttttct
acggacgaggccggggcgcagctattcgctcagagcttcaactcgagcgccgagcaggtg
cggttcctaaacacagtcgccaactgggcgtacgacaccaacatcaccgaggagaacgcg
cagcgccaggaggagacagccctgataagccaggacttcgatgaggcctggggctacaag
gccaaggagctgtatgacaacatctggcaaaacttcaccaacccacagctacgcagggtc
atccgctccatccgcatcctgggccctgccaacctggccctggcgaagcggcagcagtac
aactctctgctaagcaacatgagcagaatttactccacatccaaggtctgcttccccaac
aagactgccacctgctggtcactggacccagagctcaccaacatcctggcctcctcgagg
agctacaccatgctactctttgcctgggagggctggcatgatgctgtgggcatcccgctg
aaacccctgtaccaggactttaccgccctcagcaacgaggcctacaagcaggatggcttc
tccgacacaggggactactggcgctcctggtatgaatcacccacctttgtggaggatctg
gagtacctctaccatcagttagagcctctctacctgaacctccatgcctacgtccgccgt
gcactgcaccgccgatacggggacaagttcatcaacctcaggggacccatccctgcacat
ctgctgggaaacatgtgggcccagagctgggaaaacatctacgacatggtggtgcctttc
ccagacaagcccaacctggatgttaccagtactatggtgcagaagggctggaacactacg
cacatgtttcgggtggcagaggagttcttcacctccctgggcctcctgcccatgccacct
gagttctgggcacactccatgctggagaagccgagcgatgggcgggaggtggtgtgccac
gcctctgcctgggacttctacaacaggaaggacttcaggatcaagcagtgcacacgggtc
acgatggaccagctatcaacggtgcaccacgagatgggccacgtgcagtactacctgcag
tacaaggaccagcccgtgtccctgcgcgaaggcgccaaccccggcttccatgaggccatc
ggggatgtgctggcactctcggtctccactcctgcacatctgcacaaaatcggccttctg
gaccaagtcaccaatgacacagaaagtgacatcaattacctgctaaagatggcgctggaa
aaaattgccttcctgccctttggctacttggtggaccagtggcgatggggggtctttagt
gggcgcacccccccttccctctacaactttgactggtggtatctccgaaccaagtatcag
gggatctgccctccagttgtccgaaatgaaacccactttgatgctggagctaagtttcat
gtcccaaacatgacaccatacatcaggtactttgtgagttttgtcctgcaattccagttc
catcaagccctgtgcaaggaggcagcccaccagggccccctgtaccagtgtgacatctac
cagtccacccaggcagggaacaaactccgagagctgcttcaggcgggctcctcaaggccc
tggcaggagctgctgaaggacatgatcggctcagatgccctggatgcccaaccactgctc
aactacttccagccggtcagccagtggctgcaggaacagaaccagcgcaacggcgaagtc
ctgggctggccagaatatcagtggcgcccgccactgcccgacaattacccagagggcatt
gacttggtcacagatgaggctgaggcccagaagtttgtggaggaatatgacaagacagcc
caagtcgtgtggaatgaatatgctgaggccaattggaactacaataccaacatcacccaa
gaggccagcaagattctgctgcaaaagaatatgcagttggcaaaccacaccctgaggtat
ggcacccaggccaagcagtttgatgtgaccaacttccagaacgaaaccaccaagcggatc
atgaagaaagttcaggacctggatcgggcggtgctgcctactgaggagctggagcagtac
aaccagatcctgctggacatggaaaccacttacagtatggcctccgtgtgccatctaaat
ggcacttgtctacaactagagcctgacctgacgaagctgttggccacatcccggaactat
gaagagttgttatgggcatgggaggcctggcgagacaaggtgggcagagcaatccttcct
ttttttcccaaatatgtggaactgagcaacaaggctgcaaagctcaatggctacaaagac
acaggagactcgtggagagctatgtacgagacgccattgctagaacacgacctggagttg
ctcttccaggagcttcagccactatacctgaacctacacgcctacgtgcgccgcgcccta
catcgtcactatgggcccgagcgcatcaacctggagggccctattcctgcccatctgctg
gggaatatgtgggctcagacctggtccaacatctatgacttggtagtgcccttcccttca
gcccccaagatggatgccactgaggctatgataaagcagggctggacacctaaaaggatg
tttgaggaagctgacaacttcttcacctccttggggctgctgccagttcccccattgttc
tggaacaagtcgatgctggagaagccaacagatgggcgggaggtggtatgccatgcttct
gcctgggacttctacaatggcaaggacttcaggattaagcagtgcaccactgtggacatg
gaagacctggtggtagcccaccatgagatgggccacatacagtatttcatgcaatacaag
gacttgcctttggccttacgggagggtgccaaccctggctttcacgaggccattggggat
gtgctggccctttcagtatctacgccccagcacctatacagcatcaacctgctgagtagc
gagggtggtggctacgagcacgacatcaactttctaatgaagatggcactggacaaggtc
acctttatccccttcagctacctggtcgaccagtggcgctggagggtatttgacggaagc
atcaacaaggaaaactacaaccaggagtggtggagcctcaggctgaagtaccagggcctc
tgcccccctgtgtccaggtctcaaggcgactttgacccaggggccaagttccacattcct
tcgagtgtgccttacatcaggtactttgtcagctttgtgatccagttccagttccatgag
gcactgtgccaggcggctggccatcagggccccctgtacaagtgtgacatctaccagtcc
aaggaggcagggaagcgcctggcggatgccatgaagctgggcttcagtaagccatggccg
gaagccatgagactgatcaccgggcagcccaacatgtcggctacggccatgatgaactac
ttcaagccactgctnnnnnnnnnnnnnnnnnnnnngggcagggaagccaagctagcggcc
cccagccctgcctaccgccctgcccaccaccctactctccttgcttcccgcccagctcat
tcagaagcctccttcacgggcagcggccgagtcaactttctgggcctggaactggaagca
caccaggcccgagtgggccagtgggtgctactcttcctgggcgtcgccctactggtggcc
acattggggctgacccagcggctcttcagcatccgccaccagagcctccgccatccacac
cgagggccccagttcggctccgaggtggagctgagacactcctga

DBGET integrated database retrieval system