KEGG   Loxodonta africana (African savanna elephant): 100667734
Entry
100667734         CDS       T04351                                 

Gene name
EMD
Definition
(RefSeq) emerin
  KO
K12569  emerin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100667734 (EMD)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100667734 (EMD)
   05414 Dilated cardiomyopathy
    100667734 (EMD)
SSDB
Motif
Pfam: LEM
Other DBs
NCBI-GeneID: 100667734
NCBI-ProteinID: XP_003421744
LinkDB
Position
Unknown
AA seq 256 aa
MDDYAVLSDAELVAMLRQYNIPHGPVVGSTRKLYEKKIFEYETQRRRLSPPNSSASSFSY
GFSDLDSTSEDSDKYDLPKKEDALLYQSKGSNDDYYEESYLHTRTYGEPESVGTSKNFRE
PMASLSDAESFRRQMREDNLFTSEEEGKDRECPSYARDSAYQSIAYYRPISSISKGTLGQ
PYYPTTSSTSSTSSSSYSPPSWLARRAIRPEKQVPGASLSQDRQVPLWGQLLLFVVFAAF
LVFVYYSMQAEDGNPF
NT seq 771 nt   +upstreamnt  +downstreamnt
atggacgactacgcggttctgtcggacgcggagctggtcgccatgctacgccagtacaac
atcccgcacggacccgtcgtgggctccactcgcaagctctatgagaagaagatcttcgag
tacgagacccagaggcggagactttcgcccccgaactcgtccgcctcctcgttctcctat
gggttctcggatttggattcaacatctgaggactcggataagtacgatctgcccaagaaa
gaggatgccttactataccagagcaagggctctaatgatgactactatgaggagagctac
ttgcacaccaggacttatggggagcctgagtcagtgggcacatccaagaactttcgggag
cccatggcttcgctctcagatgctgaaagttttcgccgtcagatgcgtgaagacaatctt
ttcacttccgaagaggagggcaaggatagggaatgtccctcgtatgccagggacagtgcc
taccagagcatcgcgtactaccgccccatctcgagcatctccaagggtaccctgggccaa
ccctattatcctaccacctcctccacctcctccacctcctcatcttcatactctccacct
tcgtggctcgcccgccgtgccatccggccagaaaagcaggtcccgggagccagtctgagt
caggaccgccaggtccctctctggggccagttgctcctgttcgtggtctttgctgccttc
ctagtcttcgtttactattcgatgcaggcagaggatggcaaccccttctag

DBGET integrated database retrieval system