KEGG   Loxodonta africana (African savanna elephant): 100667785
Entry
100667785         CDS       T04351                                 

Gene name
FH
Definition
(RefSeq) fumarate hydratase, mitochondrial isoform X1
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00020  Citrate cycle (TCA cycle)
lav00620  Pyruvate metabolism
lav01100  Metabolic pathways
lav01200  Carbon metabolism
lav04934  Cushing syndrome
lav05200  Pathways in cancer
lav05211  Renal cell carcinoma
Module
lav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100667785 (FH)
   00620 Pyruvate metabolism
    100667785 (FH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100667785 (FH)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100667785 (FH)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100667785 (FH)
Enzymes [BR:lav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     100667785 (FH)
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C DUF4288
Other DBs
NCBI-GeneID: 100667785
NCBI-ProteinID: XP_003410962
UniProt: G3SWS6
LinkDB
Position
Unknown
AA seq 508 aa
MSRALRFLARQDRLVRPAAPGSAPGLGSSAGLPSRPPNAARMASQNSYRIEYDTFGELKV
PNDKYYGAQTVRSTMNFKIGGVTERMPAPVIKAFGILKRAAAEVNQDYGLDPKIASAIMK
AADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVN
KSQSSNDTFPTAMHIAAATEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPL
TLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTG
LPFVTAPNKFEALAAHDALVELSGAMNTAACSLMKIANDIRFLGSGPRSGLGELILPENE
PGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARL
LGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTL
KGTAIELGYLTAEQFDEWVKPADMLGPK
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgagccgagcgctccgattcctcgcgcgccaggatcgcctcgtgcggcctgcagcccca
ggctccgctcccggcctcggtagctctgccggcctcccatcccggcccccgaacgctgct
cgaatggcgagccagaattcctatcggatagaatatgacactttcggtgaactcaaggtc
ccaaatgataagtattatggtgcccagacagtgagatccacgatgaactttaagattgga
ggtgtaacagaacgcatgccagccccagttattaaagcttttggcatcttaaagcgagca
gctgctgaagtaaaccaggattatggtcttgatccaaagattgccagtgcaataatgaag
gcagcagatgaggtagctgaaggtaaattaaatgatcattttcctctcgtggtatggcag
actggatcaggaacccagaccaatatgaatgtaaatgaagtcattagcaatagagcaatt
gaaatgttaggaggcgaacttggcagcaagaaacctgtacatcctaatgatcatgttaat
aaaagccagagctcaaacgatacttttcccactgcaatgcacattgccgccgcaacagaa
gtgcatgaagtactgttaccaggattgcagaagctacatgacgctcttgatgcgaaatcc
aaggagtttgcccagatcatcaaaattgggcgtacccatacgcaggatgctgttccactt
actcttggacaggaatttagtggttacgttcaacaagtgaaatatgcaatgacgagaata
aaagctgccatgccgagaatctatgagctcgcagccggaggcactgctgttggtactggc
ttaaatactagaattggctttgcagaaaaggttgctgcaaaagtggctgcactcacaggc
ttgccttttgtcacggctccaaataaatttgaagctctggctgctcacgatgccttggtt
gaactcagtggtgccatgaacactgccgcttgcagtctgatgaagatagcaaatgatatc
cgttttctgggctctggtcctcggtcgggtctgggagaactgatcttgcctgagaatgaa
ccaggaagcagtatcatgccaggaaaggtgaaccccacccagtgtgaagcaatgaccatg
gttgccgcacaagtcatggggaatcacgttgctgttactgttggaggcagcaatggacat
tttgagttgaatgttttcaagccaatgatgattaaaaatgtgttacactcagcaaggctg
ctgggggatgcttcagtttccttcacagaaaactgcgtggtgggaatccaggccaacaca
gaaagaatcaacaagctaatgaatgagtctttaatgttggtgacggcgcttaatccccat
atagggtatgacaaggcagcaaagattgctaagacagcacacaaaaatggatcaacctta
aagggaactgccattgaacttggctatctcacagcagagcagtttgatgagtgggtgaaa
cctgcagacatgctggggccaaagtag

DBGET integrated database retrieval system