KEGG   Loxodonta africana (African savanna elephant): 100667788
Entry
100667788         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: neurophysin 2-like
  KO
K05242  arginine vasopressin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04072  Phospholipase D signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04270  Vascular smooth muscle contraction
lav04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100667788
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100667788
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100667788
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100667788
SSDB
Motif
Pfam: Hormone_5
Other DBs
NCBI-GeneID: 100667788
NCBI-ProteinID: XP_003411494
LinkDB
Position
Unknown
AA seq 167 aa
MPDTTLHALASSNLLGLTSALLLPECPRGGKEAMSDMELRQCLPCGPGGKGRCFGPSICC
GEELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCYEESCVTEPECREG
AGIHRRTRASDRSNATQLDGPAGALLLRLVQLAGAPEPEEPAKPGVY
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcctgacaccacgctgcatgcgctggcttcatcgaacctgctgggcctcacctccgcc
ctgctacttccagaatgcccgaggggcggcaaggaggccatgtcggacatggagctgagg
cagtgcctcccctgcggccccgggggcaaggggcgctgcttcgggcccagcatctgctgc
ggggaagagctgggctgcttcgtgggcaccgccgaggcgctgcgctgccaggaggagaac
tacctgccgtcgccctgccagtctggccagaagccatgcgggagcggtggccgctgcgcc
gcggccggcatctgctgctatgaggagagctgcgtgacggagcccgagtgccgggagggc
gccggcatccaccgccgcacccgcgccagcgaccggagcaacgcgactcagctggacgga
ccggccggggccttgctgctgcggctggtgcagctggcgggggcgcccgagcccgaggag
cccgccaagcccggcgtctactga

DBGET integrated database retrieval system