KEGG   Loxodonta africana (African savanna elephant): 100667822
Entry
100667822         CDS       T04351                                 

Gene name
RASD1
Definition
(RefSeq) dexamethasone-induced Ras-related protein 1
  KO
K07843  RAS, dexamethasone-induced Ras-related protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04713  Circadian entrainment
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04713 Circadian entrainment
    100667822 (RASD1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100667822 (RASD1)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Ras Family
   RasD
    100667822 (RASD1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB TniB HSP70 AAA_24 MMR_HSR1
Other DBs
NCBI-GeneID: 100667822
NCBI-ProteinID: XP_003420704
UniProt: G3T9S9
LinkDB
Position
Unknown
AA seq 279 aa
MKLAAMIKKMCPSDSELSIPSKNCYRMVILGSSKVGKTAIVSRFLTGRFEDTYTPTIEDF
HRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQ
ILDTKSCLKNKTKENVDVPLVICGNKGDRDFQREVEQREIEQLVGDEPQRCAYFEISAKK
NSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRSKKLLRAGGGSCEPGDA
FGIVAPFARRPSVHSDLMYIREKASGGGQAKDKERCVIS
NT seq 840 nt   +upstreamnt  +downstreamnt
atgaaactggccgcgatgattaagaagatgtgtccgagcgactcggagctgagtatccca
tccaagaactgctaccgcatggtcatcctcggttcgtccaaggtggggaagacggccatc
gtgtcgcgcttcctcacgggccgcttcgaggacacctacacgcccaccatcgaggacttc
caccgcaagttctattctatccgcggagaggtctaccaactcgacatcctggacacgtcc
ggcaaccacccgttccccgccatgcggcgcctctccatcctcacaggagacgttttcatc
ttagtgttcagcctagacaaccgcgactccttcgaggaggtgcagaggctcaagcagcag
attcttgacacaaagtcttgcctcaagaacaaaaccaaggagaacgtggacgtgcccctg
gtcatctgcggtaacaagggtgaccgggacttccaacgcgaagtggagcagcgcgaaatc
gagcagctagtgggcgatgaaccccagcgctgcgcctacttcgagatctcggccaagaag
aacagcagcctggaccaaatgttccgagcgctcttcgccatggccaagctgccgagcgag
atgagcccagacctgcaccgtaaggtgtcggtgcagtactgcgacgtgctgcacaagaaa
gcgctgcgcagcaagaaactgttgcgcgccggcggcggcagctgcgagccgggcgacgcc
tttggcatcgtggcgcccttcgcgcgcagacccagcgtgcacagcgacctcatgtacatc
cgcgagaaggccagcggcggcggccaggccaaggacaaggagcgctgcgtcatcagctag

DBGET integrated database retrieval system