KEGG   Loxodonta africana (African savanna elephant): 100667886
Entry
100667886         CDS       T04351                                 

Gene name
AR
Definition
(RefSeq) androgen receptor isoform X1
  KO
K08557  androgen receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav05200  Pathways in cancer
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100667886 (AR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100667886 (AR)
  09162 Cancer: specific types
   05215 Prostate cancer
    100667886 (AR)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100667886 (AR)
Nuclear receptors [BR:lav03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100667886 (AR)
SSDB
Motif
Pfam: Androgen_recep Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100667886
NCBI-ProteinID: XP_003412790
UniProt: G3TXN4
LinkDB
Position
Unknown
AA seq 897 aa
MEVQLGLGRVYSRPQSKTYRGAFQNLFQSVREVIQNPGPRQPEATSAAPPGARLKQQQQQ
QQQEEISPRQQQQQQGEDGSPQAQSRGPTGYLALDKEQQPSQQPSASEGHPESGCIPEPG
AAATAGNGLPQQPPAPPEEDDSAAPSTLSLLGPTFPALSSCSADLKDILSEAGTMQLLHH
QQQQQQQQQEAVSEGSNSNGRAREAAGASISSKDGYLGGTSTISDSAKELCKAVSVSMGL
GVEALEHLSPGEHLRGDCMYAPLLGGPPPVRPTPCAPLAECKGSVLDECPGKDTEEPAEY
APFKGGYAKGLDGESLGCSGSGEAGGSGTLDLPSTLSLYKSGALDEVAAYQSRDYYNFPL
ALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLGSLHGGGAAGPGSGSPSA
AASSWHTLFTSEEGQLYGPCGGGGGSGSGVEAGTVAPYGYSRPSQGLAGQESDFPPPDVW
YPGGMVSRVPYPSPSCVKSEMGPWMESYSGPYGDVRLETARDHVLPIDYYFPPQKTCLIC
GDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEA
GMTLGARKLKKLGNLKLQEEGEVSSATSPTEEPTQKLTVSHIEGYECQPIFLNVLEAIEP
GVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWM
GLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQ
EFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKL
LDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
NT seq 2694 nt   +upstreamnt  +downstreamnt
atggaggtgcagttagggctggggagggtctactcccggccgcagtccaagacctatcga
ggagctttccagaacctgttccaaagcgtgcgcgaagtgatccagaacccaggaccccgg
caacctgaggcgacgagcgcggcacctcccggcgcccgtttgaagcagcagcaacagcag
cagcagcaggaggagatcagcccccgccagcagcagcagcagcagggtgaggatggctct
ccgcaagcccagagcagaggccccacaggctacctggccctggacaaggagcagcaacct
tcacaacagccgtcagcctccgagggccaccccgagagcggctgcatcccagagcccgga
gctgccgcgaccgctggcaacgggctgccgcagcagccgccagcacctccggaggaggat
gactcagctgccccatccacattgtccctgctgggccccactttcccagccttaagcagc
tgctccgccgaccttaaagacatcctgagtgaggccggaaccatgcaactccttcatcat
cagcagcagcagcagcagcagcagcaggaggcagtatccgaaggcagcaacagcaacggg
agagcaagagaggccgcaggggcttccatctcctccaaggacggttacctagggggcact
tcaaccatctcagacagcgccaaggagttgtgtaaggcagtgtcggtgtccatgggcttg
ggtgtggaggcgttggaacatctgagtcctggggaacaccttcggggggattgcatgtac
gccccactcctgggaggtccaccccctgtacgtcccactccttgcgccccgctggctgaa
tgcaaaggctctgtactggacgaatgcccaggcaaggacactgaagaacctgctgagtat
gcccctttcaagggaggttacgccaaagggctggacggcgagagcctaggctgctctggc
agcggcgaagcagggggctccgggacacttgatctgccgtccaccctgtctctctacaag
tccggagcactggatgaggtagcagcgtaccagagtcgcgactattacaactttccactg
gccctggctgggcccccgcctcctccgccgcccccccacccccatgcccgcatcaagctg
gagaaccccctggactacggtagcgcctgggcggcagcggcagcacagtgccgctacggg
gacctggggagcctgcacggcgggggtgcagcgggacccggatccggttcaccctcagca
gccgcctcttcctggcacactctcttcacaagcgaagaaggccagctgtatgggccgtgt
ggcggtggcggtggcagcggctcaggggtcgaggcggggaccgtagcgccctatggttac
tctcggccatctcaggggctggcgggccaggagagcgacttccctccacccgatgtgtgg
taccctggcggcatggtgagcagagtgccttaccccagccccagttgtgtcaaaagcgag
atgggcccctggatggagagctactccggaccttatggggacgtgcgtttggagactgcc
agagaccatgttcttcccatcgactattactttccaccccagaagacctgcctgatctgt
ggggatgaagcttctggctgtcactatggagcactcacttgtggaagctgcaaagtcttc
tttaagagagctgctgaagggaaacagaagtacctgtgtgccagcagaaatgattgcacc
attgataaattccgaaggaaaaattgtccatcatgtcgcctccggaaatgctatgaagca
gggatgactctgggagctcgaaagctgaagaaacttggtaacctgaagctgcaggaggaa
ggggaggtttccagtgcaacgagccccactgaggagccaactcagaagctgacagtgtca
cacatcgaaggctatgagtgtcagcccatctttctgaatgtcctggaagccattgagcca
ggcgtggtgtgtgctggacatgacaacaaccagcccgactcctttgcagccttgctctct
agcctcaatgaattaggcgagagacagcttgtacatgtggtcaaatgggccaaggctttg
cctggcttccgcaacttgcacgtggatgaccagatggcagtcattcagtattcctggatg
gggctcatggtgtttgccatgggctggcggtccttcaccaacgtcaactccagaatgctc
tacttcgcccctgacctggttttcaatgagtaccgcatgcacaaatcccggatgtacagc
cagtgtgtccgaatgaggcacctctcccaagagtttggatggctccaaatcaccccccag
gaattcctgtgcatgaaagcattactgctgttcagcattattcccgtggatgggctgaaa
aatcaaaaattctttgatgaacttcgaatgaactacatcaaggaactcgatcgtatcatt
gcatgcaagagaaaaaatcccacatcctgctcaaggcgcttctaccagctcaccaagctc
ctggactctgtgcagcctattgcacgagagctgcatcagttcacttttgacctgctaatc
aagtcccacatggtgagcgtggactttccggaaatgatggcagagatcatctctgtgcaa
gtgcccaagatcctttctgggaaagtcaagcccatctattttcacacacagtga

DBGET integrated database retrieval system