KEGG   Loxodonta africana (African savanna elephant): 100668092
Entry
100668092         CDS       T04351                                 

Gene name
NCEH1
Definition
(RefSeq) neutral cholesterol ester hydrolase 1 isoform X1
  KO
K14349  neutral cholesterol ester hydrolase 1 [EC:3.1.1.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
lav04976  Bile secretion
lav04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100668092 (NCEH1)
  09154 Digestive system
   04976 Bile secretion
    100668092 (NCEH1)
   04979 Cholesterol metabolism
    100668092 (NCEH1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100668092 (NCEH1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100668092 (NCEH1)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     100668092 (NCEH1)
Peptidases and inhibitors [BR:lav01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   100668092 (NCEH1)
SSDB
Motif
Pfam: Abhydrolase_3 COesterase Peptidase_S9 Say1_Mug180 Chlorophyllase2 AXE1 Esterase_PHB
Other DBs
NCBI-GeneID: 100668092
NCBI-ProteinID: XP_010594331
UniProt: G3T4Z1
LinkDB
Position
Unknown
AA seq 408 aa
MRSSCVLITALVALAAYYVYIPLPNSVADPWKLMLLDATFRGAQQVSNLIHCLGLSHHLL
ALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEVRVFEGSPKPEEPLRRSVLYIHGGGWALA
SPKISYYDELCTAMAKELNAVIVSIEYRLVPKVYFPEQIHDVVRAAKYFLQPEVLEKYSV
DPSRIGISGDSAGGNLAAALGQQFSQDASLRNKLKLQALIYPVLQALDFNTPSYQQNANT
PILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVQEAAALRARLNWTSLLPASITKNY
KPVMHTTGNARIVQEIPQLLDARSSPLIADQEVLQHLPKTYILTCEYDVLRDDGIMYAKR
LENAGVEVTLDHFEDCFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaggtcgtcctgtgtcctgatcaccgccctggtggcgctggccgcctactacgtctac
atccccctgcccaactcggtggctgatccctggaagctgatgctgctggacgcgactttc
cggggtgcacagcaagtgagcaacttgatacactgcctgggcctgagccatcatctgctc
gccctgaattttatcatcgtttctttcggcaagaaaagtgcatggtcgtctgctcaggtg
aaggtgactgacaccgactttgacggggtggaagtcagagtgtttgaaggctctccaaag
ccagaagagcctctgagacgcagcgttctttacatacacggaggaggctgggctttggcc
agtccaaaaatcagctactatgatgaactatgtacagcaatggccaaggaattgaatgct
gtcattgtctccattgaatacaggctagttccaaaggtttattttcccgaacaaattcac
gatgttgtacgtgccgcgaagtatttcctgcaaccagaagtcctagagaagtattcggtt
gacccaagcagaattggcatttctggtgacagtgctggtggtaatttggctgctgccctc
gggcaacagtttagtcaagacgccagtctaagaaacaagctcaaactgcaagctttaatt
tatccggttcttcaagctctagattttaacacaccctcttatcagcagaatgcgaacacc
ccaatcctgccccgctacgtcatggtgaagtattgggtggattacttcaaaggcaactat
gactttgtccaggcaatgatagttaacaatcacacctcccttgatgtgcaagaggctgct
gccctcagggcccgtctaaactggacatccctcttgcctgcatccatcacaaagaactac
aagccagtcatgcacaccacgggcaatgccaggattgtccaggagatccctcagttgctc
gatgcccgttcttccccacttattgcagaccaggaagtcctccagcacctcccaaagacc
tatattctcacctgtgagtatgacgtcctaagagacgatgggatcatgtatgcaaagcgt
ttggagaatgcaggtgtggaggtgacccttgaccactttgaggattgcttccacgggtgc
atgatttttaccagctggcccaccaacttctcagtgggaatccggactagaaatagttat
atcaagtggctggatcaaaacctataa

DBGET integrated database retrieval system