KEGG   Loxodonta africana (African savanna elephant): 100668134
Entry
100668134         CDS       T04351                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04115  p53 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04218  Cellular senescence
lav04914  Progesterone-mediated oocyte maturation
lav04934  Cushing syndrome
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05215  Prostate cancer
lav05222  Small cell lung cancer
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100668134 (CDK2)
   04151 PI3K-Akt signaling pathway
    100668134 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100668134 (CDK2)
   04114 Oocyte meiosis
    100668134 (CDK2)
   04115 p53 signaling pathway
    100668134 (CDK2)
   04218 Cellular senescence
    100668134 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100668134 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668134 (CDK2)
   05203 Viral carcinogenesis
    100668134 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100668134 (CDK2)
   05215 Prostate cancer
    100668134 (CDK2)
   05222 Small cell lung cancer
    100668134 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100668134 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100668134 (CDK2)
   05161 Hepatitis B
    100668134 (CDK2)
   05160 Hepatitis C
    100668134 (CDK2)
   05162 Measles
    100668134 (CDK2)
   05169 Epstein-Barr virus infection
    100668134 (CDK2)
   05165 Human papillomavirus infection
    100668134 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100668134 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lav03032]
    100668134 (CDK2)
   03036 Chromosome and associated proteins [BR:lav03036]
    100668134 (CDK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100668134 (CDK2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100668134 (CDK2)
DNA replication proteins [BR:lav03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100668134 (CDK2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100668134 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 100668134
NCBI-ProteinID: XP_003405164
UniProt: G3TH75
LinkDB
Position
Unknown
AA seq 298 aa
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDETVWPGVTSMPDYKASF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaggtggaaaagatcggcgagggcacgtacggagttgtgtacaaa
gccaaaaacaaggtgacgggagaagtggtggcgcttaagaaaatccgtttggacactgag
acagagggtgtacccagtactgccatccgagagatctctctgcttaaggagcttaaccac
cctaatattgtcaagctgctggatgtcatccacacagaaaacaaactctacctggttttt
gagtttctgcaccaggatctcaagaaattcatggatgcctctgctctcactggcatacct
cttcccctcatcaagagctatctgttccagctgctccaggggctagctttctgccattct
catcgagttctgcaccgagacctcaaaccacagaatctgcttatcaacgcagagggggcc
atcaagttagcagactttggactagccagagcctttggagtccctgttcgtacttacacc
catgaggtggtgaccctgtggtaccgtgcacctgaaatccttctgggatgcaaatactac
tccacagctgtggatatctggagcctgggctgcatctttgcagagatggtgacccgccgg
gccctattccctggagattctgagattgaccaacttttccggatctttagaactttgggg
accccagatgagacagtttggccaggagttacttctatgcctgattataaggcgagtttc
cccaagtgggcccggcaagattttagcaaagttgtgcctcccttggatgaagatggacga
agcttgttatcgcaaatgctgcactacgaccccaacaagcgcatttcagcaaaggcagct
ctggctcaccccttcttccaggatgtgaccaagccagtaccccaccttcgactctga

DBGET integrated database retrieval system