KEGG   Loxodonta africana (African savanna elephant): 100668199
Entry
100668199         CDS       T04351                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00600  Sphingolipid metabolism
lav01100  Metabolic pathways
lav04020  Calcium signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav05152  Tuberculosis
Module
lav_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100668199 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100668199 (SPHK1)
   04371 Apelin signaling pathway
    100668199 (SPHK1)
   04020 Calcium signaling pathway
    100668199 (SPHK1)
   04072 Phospholipase D signaling pathway
    100668199 (SPHK1)
   04071 Sphingolipid signaling pathway
    100668199 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100668199 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100668199 (SPHK1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100668199 (SPHK1)
SSDB
Motif
Pfam: DAGK_cat
Other DBs
NCBI-GeneID: 100668199
NCBI-ProteinID: XP_010595234
LinkDB
Position
Unknown
AA seq 476 aa
MAPGPSRPPPPSASRGSGLRQRRLLSDPAAAGNDAGAPTAPALGGKGEPYSRPRDARLGS
TDKELKAGAAATGSSPTALGIPWQREPGVEVMDPAGGPQCPRVLLPRPCRVLVLLNPRGG
KGKALQLFRSHVQPLLVEAEVSFTLLLTEWRNHARELVRHEELGRWDALVVMSGDGLMHE
VVNGLMERPDWETAIRMPLCSLPAGSANALAASVNHYSGYQQVTNEELLINCTLLLCRRL
LSPMNLLSLHTASGLHLFSVLSLAWGFVADVDLESEKYRRLGEIRFTFGTFLRLISLRTY
QGRLAYLPVGGAASRMPTSPALGQGGPANTLLVPLDQPVPDHWTVVPEEDFVLVLALLHS
HLGSNMFIAPMGRCAAGVMHLFYVRAGVSRTMLLRLFLAMEKGRHMEYDCPHLVYVPVVA
FRLEPKDRRGMFAVDGELMVSEPVQGQVHPDCCWMVSGCVEPSSSQGPRQMPPQPL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggccccgggaccgagccggccgcccccaccctcggcgagccgcggctccggcctccgc
cagcgccgtctcctttcagatcccgcagccgcagggaatgacgcaggcgctcccacagcc
ccggccctgggcgggaagggcgagccctacagccggccccgcgacgctcgcctgggcagc
accgataaggagctgaaggcaggagccgctgccaccggcagctccccgacagcgctgggg
atcccctggcagagggagccgggggtcgaggttatggacccagcaggcggcccccagtgt
ccccgggtcctgctcccgcgtccctgccgggtgctggtgctgctgaacccccgcggcggc
aagggcaaggccctgcagctcttccggagccacgtgcagcccctgctggtggaggccgaa
gtgtccttcacgctgctgcttaccgaatggcggaaccacgcgcgggagctggtgcgccac
gaggagctgggccgctgggacgcactggtggtcatgtccggggacggtctgatgcatgag
gtggtgaacgggctcatggaaaggcctgactgggagaccgccatccggatgcctttgtgc
agcctccctgccggctctgccaacgcgctggcagcctcagtgaaccattattcagggtac
cagcaggtgactaatgaggagctcctgatcaactgtacgctgctgctgtgccgccggctg
ctgtcacccatgaacctgctgtccctgcacacggcctcggggctacacctcttctctgtg
ctcagcctggcctggggatttgttgctgacgtggacctggagagtgagaagtaccggcgc
ctgggtgagattcgattcaccttcggcacctttctccgcctcatctctctacgcacctac
cagggccggctggcctacctgcccgttggaggggctgcctctaggatgcccacctcccct
gccctgggccaggggggccctgcaaacacgctccttgtacctctggaccagccggtgccc
gatcactggactgtggtgcccgaggaggactttgtgctggtgctggcgctcctgcactca
cacctgggcagcaacatgttcatagcccccatgggccgctgtgcggccggcgtcatgcac
ctgttctatgtgcgagccggtgtgtcccggaccatgctgctgcgtctcttcctggccatg
gagaagggcagacacatggaatatgactgcccccacctggtgtatgtgccggtggtcgcc
ttccgcctggagcccaaggaccggaggggcatgtttgccgtggatggggagctgatggtc
agtgagccagtgcagggtcaggtgcatccagactgctgctggatggtcagtggctgcgtg
gagccctcgtccagccaggggcctcggcagatgccacctcagcccctgtga

KEGG   Loxodonta africana (African savanna elephant): 100676401
Entry
100676401         CDS       T04351                                 

Gene name
SPHK2
Definition
(RefSeq) LOW QUALITY PROTEIN: sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00600  Sphingolipid metabolism
lav01100  Metabolic pathways
lav04020  Calcium signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav05152  Tuberculosis
Module
lav_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100676401 (SPHK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100676401 (SPHK2)
   04371 Apelin signaling pathway
    100676401 (SPHK2)
   04020 Calcium signaling pathway
    100676401 (SPHK2)
   04072 Phospholipase D signaling pathway
    100676401 (SPHK2)
   04071 Sphingolipid signaling pathway
    100676401 (SPHK2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100676401 (SPHK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100676401 (SPHK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100676401 (SPHK2)
SSDB
Motif
Pfam: DAGK_cat
Other DBs
NCBI-GeneID: 100676401
NCBI-ProteinID: XP_003406577
LinkDB
Position
Unknown
AA seq 653 aa
MNGCLEAEEQQDQRQQDQELTWSHRPGPGSTLDRAKAMAPPAPLLAASTPLLHGEFGSYP
ARGPRFALTLTPQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSCSPLDSAAYFCIYT
YQRGRRGARRRATRTFRADGAAAYEENRAEAQRWATTLTCLLRGLPLPGDGEITPELLPR
APRLLLLVNPFGGRGXWPGKWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEW
DGIVTASGDGLLYEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFAPALGI
DLLLNCSLLLCRGGSRPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSTRF
TLGTMLGLATLHTYRGRLSYLPATGGPVSPTPTHSLPRAKSELTLAPEPALPMAHSPLHR
SVSDLPLPMPQAALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLPSPSGSP
RAAVRSPITEGPPEIPVPSGLPNPCPDVPAAASTWGPPDHLLPPLSAPLPPGWVTMEEDF
VLLLAISPSHLGADLVAAPHARFDDGLVHLCWVRGGISRATLLRLFLAMERGSHFGLGCP
QLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPVQAQIHPGLGTLLTGPPGGEP
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgaatggatgccttgaagcagaggaacagcaggaccagaggcagcaggaccaggagctg
acctggagccacagacccgggcccgggagtaccctggacagggccaaggccatggccccg
ccagcaccgctgctggccgccagcaccccactcttgcatggcgagttcggctcctacccg
gcccgtggcccccgctttgccctcacccttacaccgcaggccctgcacattcagcggctg
cgcccgaagcctgaagcccggccccgtggtggtctggtcccactggccgaggtctcgggc
tgctgcaccctgcgcagctgcagccccttggactccgcagcctacttctgcatctacacc
taccagcggggccggcgtggggcccggcgcagagccacacgcaccttccgggccgacggg
gcagcagcctatgaggagaaccgcgctgaggcccagcgctgggccaccaccctcacgtgc
ctgctccgtgggctgccactgcctggggatggggagatcactcccgagctgctgccccgg
gcccctcgcttgctcctattggttaatccctttggggggcggggcncctggcctggcaaa
tggtgtaagaaccatgtgcttcccatgatctccgaagctgggctgtccttcaacctcata
cagacagaacggcagaaccacgcccgggagctggtccaggggctgagcctgagcgagtgg
gatggcattgtcacggcctcaggagacgggctgctctatgaggtgctgaatgggctcctt
gatcgcccggactgggaggaggctgtgaagatgcctgtgggcatcctcccatgtggttca
ggcaatgcactggccggagcagtgaaccagcatggagggtttgcaccagccctgggcata
gacctgctgctcaactgctctctactgctctgccggggtggcagccgcccgctggacctg
ctctctgtgacactggcctcgggctcccgctgtttttccttcctgtctgtggcctggggc
ttcgtgtcagacgtggacatacagagcgagcgtttcagggccctaggcagcacccgcttc
actctgggcacgatgttgggcctcgccacactgcatacctaccgcggacgcctctcctac
ctccctgccactgggggacctgtctcgcccacacccacccatagcctgccccgggccaag
tcggagctgaccctggccccagagccagccttgccaatggcccactcgcccctgcaccgc
tcagtgtctgacctgcccctgcccatgcctcaggctgccctggcctcccctggctcacct
gaacccctgcccattctgtccctcaatggtggcggcccagagttggctggggactggggt
ggggctggggatgctccactgtccccggacccactgctgccctccccctctggctccccc
agagcagctgtccgttcacccatcactgaggggccaccagaaattccagtaccctctggg
cttccgaatccctgccctgatgtgccggcagctgcctccacatggggcccacctgaccac
ttgctgcctcctctaagtgccccactgcctccaggctgggtgacgatggaagaggacttt
gtgctcctgttggccatctcacccagccacctgggcgctgacctggtggcagccccgcat
gctcgttttgacgacggtctggtgcacctgtgctgggtgcgtggtggcatctcgcgggcc
accctgttgcgccttttcctggccatggagcgtgggagccactttggcctgggctgtccc
cagctgggctatgccgcggcccgtgcgttccgcctcgagccactgacgcctcgcggtgtg
ctcacggtggacggcgagcaggtggagtacggaccagtgcaagcgcagatacacccaggt
ctgggtacgctgctcactgggccgcctgggggcgagccctga

DBGET integrated database retrieval system