KEGG   Loxodonta africana (African savanna elephant): 100668259
Entry
100668259         CDS       T04351                                 

Gene name
ADRA1A
Definition
(RefSeq) alpha-1A adrenergic receptor
  KO
K04135  adrenergic receptor alpha-1A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100668259 (ADRA1A)
   04022 cGMP-PKG signaling pathway
    100668259 (ADRA1A)
   04152 AMPK signaling pathway
    100668259 (ADRA1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100668259 (ADRA1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100668259 (ADRA1A)
   04270 Vascular smooth muscle contraction
    100668259 (ADRA1A)
  09154 Digestive system
   04970 Salivary secretion
    100668259 (ADRA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100668259 (ADRA1A)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    100668259 (ADRA1A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 100668259
NCBI-ProteinID: XP_003412511
UniProt: G3SL07
LinkDB
Position
Unknown
AA seq 466 aa
MVFLSGNASDSSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGVMALLCVWAFSLVISIGPLFGWRQPAPDDETICQITE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPTGSSGAFSAKSKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
SKPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHALGYTL
HAPSQALEGQHKDMVRIPVGSGETFYKISKKDGVCEWKFFSSMPGGSARITVPKDQSACT
TARVRSKSFLHVCCCVGPSTPSLGENHQVPTIKIHTISLGENGEEV
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggtgtttctctccgggaatgcctccgacagctccaactgcactcacccgcccgcaccg
gtgaacatttctaaggccattctgctcggggtgatcttaggaggcctcatcattttcggg
gtgctgggaaacatcctagtgatcctctccgtggcctgccaccggcatctgcactcggtc
actcactactacatcgtcaacctggccgtggcggaccttctgctcacttccacggtgctg
ccgttctccgcgatctttgagatcctgggttactgggcctttggcagggtcttttgcaat
atctgggcagcggtggacgtcctgtgctgcaccgcgtccatcatgggactctgcatcatc
tccattgaccgctacatcggcgtgagctacccgctgcgataccccaccatcgtgacccag
agaaggggtgtcatggctctgctctgcgtctgggcattctccctggtcatctccataggg
cctctgttcggctggaggcagccggcccccgacgacgagaccatctgccagatcacggag
gagccaggctatgtattgttctcggctctgggctccttctacgtcccgctggccattata
ctagtcatgtactgccgggtctacgtggtggccaagagggagagtcggggcctcaagtct
ggcctcaagaccgacaagtcggactccgagcaggtgacgctccgcatccatcgaaaaaat
gtccccacagggagcagcggagccttcagcgccaagagtaagacgcacttctccgtgagg
ctcctcaagttctcccgggagaagaaagcagccaaaacgctgggcatcgtggtcggctgc
ttcgtcctctgctggctgccttttttcttagtgatgccaattgggtctttcttccctgat
tccaagccctcggaaaccgtttttaaaatagcgttttggctcggctacctaaacagctgc
atcaaccccatcatatacccctgctcgagtcaagagtttaaaaaggcgtttcagaacgtc
ttaagaatccagtgtctccgcagaaagcagtcttccaaacacgctctgggctataccctc
cacgcgcccagccaggccctggaggggcagcacaaggacatggtgcgcatcccagtggga
tcaggagagaccttctataagatctccaagaaggatggggtctgtgaatggaaatttttc
tcttccatgcccggtggatctgccaggattacagtgcccaaagaccaatcagcctgcacc
acagcgcgggtgagaagtaaaagctttttgcacgtctgctgctgtgtggggccatcgacc
cccagcctcggagagaaccatcaagttccaaccattaagatccacaccatctccctcggt
gaaaatggggaggaagtctag

KEGG   Loxodonta africana (African savanna elephant): 100675999
Entry
100675999         CDS       T04351                                 

Gene name
ADRA1B
Definition
(RefSeq) alpha-1B adrenergic receptor
  KO
K04136  adrenergic receptor alpha-1B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100675999 (ADRA1B)
   04022 cGMP-PKG signaling pathway
    100675999 (ADRA1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100675999 (ADRA1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100675999 (ADRA1B)
   04270 Vascular smooth muscle contraction
    100675999 (ADRA1B)
  09154 Digestive system
   04970 Salivary secretion
    100675999 (ADRA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100675999 (ADRA1B)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    100675999 (ADRA1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv Shisa
Other DBs
NCBI-GeneID: 100675999
NCBI-ProteinID: XP_003404918
UniProt: G3TGG6
LinkDB
Position
Unknown
AA seq 518 aa
MNPNLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSAALEILGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDPLSSSKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVVWLGYFNSCLNPIIYPCSSKEFKRAFM
RILGCQCRGRRRRRRRRRLGGGAYTYRPWTRGCSLERSQSRKDSLDDSGSCLSGSQRTLP
SASPSPGYLGRGAPPPVELCAFAEWKAPGALLSLPAPEPLGRRGRQDSGPLFTFRLLAEP
ESPETDGGASNGGCDAAADVANGQPGFKPNMPLAPGHF
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgaatcccaatctggacaccggccacaatacatcagcacctgcccactggggagagttg
aaaaatgccaacttcactggccccaaccagacctcgagcaactccacactgccccagctg
gacatcaccagggccatctctgtgggcctggtgctgggcgccttcatcctctttgccatc
gtgggcaacatcctcgtcatcttgtctgtggcctgcaaccgacacctgcggacgcccacc
aactacttcatcgtcaacctggcgattgccgacctgctgttaagcttcaccgtcctgccc
ttctcagctgccctcgagattcttggctattgggtactggggcggatcttctgtgacatc
tgggcggccgtggacgtcttgtgctgcacagcgtccattctgagcctgtgcgccatctcc
atcgatcgctacattggggtgcgctactctctgcagtatcccacactggtcacccgcagg
aaggccatcttggcgctcctgagtgtctgggtgctgtccacggtcatctccatcgggcct
cttcttggatggaaggagccagcgcccaacgatgacaaggaatgtggggtcactgaagaa
cccttctacgccctcttctcctccctgggctccttctacatccctctggcggtcattctg
gtcatgtactgccgggtctacatcgttgctaagaggaccactaagaacctggaagcggga
gtcatgaaggagatgtccaactccaaggagctcaccctgaggattcactccaagaacttt
cacgaggacccccttagcagtagcaaggccaagggccacaaccccaggagttccatagct
gtcaaactttttaaattctccagggaaaagaaagcagccaagaccttgggcattgtggtc
ggtatgttcatcttgtgttggctacccttcttcatcgctctaccacttggctccctgttc
tccacactgaagccccctgacgccgtgttcaaggtggtggtctggctgggctacttcaac
agctgcctcaaccccatcatctacccgtgctccagcaaggagttcaagcgcgccttcatg
cgcatcctcgggtgccagtgtcgcggtcgtcgccgccgccgtcgccgtcgccgcctgggc
ggcggcgcctacacctaccggccgtggacgcgcggctgctcgctggagcgctcgcagtcg
cgcaaggactcgctggacgacagcggcagctgcctgagcggcagccagcgaactctaccc
tcggcctcgccgagccccggctacctgggccgcggcgctccgccgccggtcgagctgtgc
gccttcgccgagtggaaggcacctggcgccctgctgagcctgcccgcgccggagcccctg
ggccgtcgcggccgccaagactcgggcccgctcttcactttcaggctcctggccgagccc
gagagccccgagaccgacgggggcgccagcaacgggggctgcgatgccgcggccgacgtg
gccaacgggcagccaggcttcaaacccaacatgcccctagcgcccgggcacttttag

DBGET integrated database retrieval system