KEGG   Loxodonta africana (African savanna elephant): 100668297
Entry
100668297         CDS       T04351                                 

Gene name
USP8
Definition
(RefSeq) LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 8
  KO
K11839  ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04137  Mitophagy - animal
lav04144  Endocytosis
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100668297 (USP8)
   04137 Mitophagy - animal
    100668297 (USP8)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100668297 (USP8)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100668297 (USP8)
Peptidases and inhibitors [BR:lav01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   100668297 (USP8)
Membrane trafficking [BR:lav04131]
 Endosome - Lysosome transport
  Others
   Others
    100668297 (USP8)
Ubiquitin system [BR:lav04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100668297 (USP8)
SSDB
Motif
Pfam: UCH USP8_dimer UCH_1 Rhodanese Metallothio_Pro HscB_4_cys
Other DBs
NCBI-GeneID: 100668297
NCBI-ProteinID: XP_023395252
LinkDB
Position
Unknown
AA seq 1084 aa
MPAVASDPKELYLSSSLKDLNKKTEVKPEKISTKNYVQSALKIFKTAEESKLDRDEEKAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPSNIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEEQLQQQKRQEAGREDGGKSAKSPLENALDSKDKTQKINGEMSEKNEITER
GAVTAKELYTMMMDKNISLIIMDARRIQDYQDSRISNSLSVPEEAISPGVTTSWIEANLP
DDSKDRWKMRGNVDYVVLLDWFSSARDLQLGTTLRSLKDALFKWESKTLLRNEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRGKNEEVSISLDFTYPSLEEPVPSKPTAQMPPPPIQVDK
NIELKKNQDERMEPLNLSTPVEPIASSKSDVSPPVQPVPIVKSVPQIDRTKKPTLKLPED
HSVKPESTDYKQQSSQDGKVVPDRSTKPTLTPTAAMLTGEEKARIHAETALLMEKSKQEK
ELQERQQEEQKEKLRREEQEARKKSEAEENEITEKEQKTKEEIEKRENEQTKKEDKETSG
KWGKEITGIKRQSRSEHETTDAKKSVEDREKRCPTPEVPKKSTGDVPQTEDSSSGKAQRE
PLTRARSEEMGRIVPGLPSGWAKFLDPVTGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPP
APKAKPQIPAERDREPSKLKRSYSSPDITQAVQEEEKRKPTVTPAVNRENKPICYPKAEI
SRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQNDI
NRSNLLGHKGEVAEEFGIIMKALWTGQYRYVSPKDFKITIGKINDQFAGYNQQDSQELLL
FLMDGLHEDLNKADNRKRHKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTV
QCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDS
LKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYSLF
SVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVT
DVAT
NT seq 3255 nt   +upstreamnt  +downstreamnt
atgcctgctgtggcttcagatcctaaagagctctacctcagttcttcactaaaagacctc
aataagaagacagaagtcaaacccgagaaaataagcactaagaattatgtacagagtgcc
ctgaagatcttcaagacagcagaagaaagcaaattggatcgtgatgaggaaaaggcctat
gtactgtacatgaaatatgtgactgtttataatctcattaaaaaaagacccgatttcaag
caacagcaggactactttcattcaattcttggaccttcaaacatcaaaaaagctattgaa
gaagccgaaagactctctgaaagccttaaactcagatatgaagaagctgaagtccggaaa
aaacttgaagaaaaggacagacaggaggaagagcaactgcagcaacagaaaaggcaggaa
gcaggaagagaggatggaggcaagtctgctaaaagtcctttggagaatgcattggattcc
aaagacaaaacccaaaagatcaatggtgaaatgagtgaaaaaaatgaaatcacagagaga
ggagcagtcacagcaaaggagctgtacacaatgatgatggataaaaacatcagcttgatt
ataatggatgctcgaagaatccaggattatcaggattcccgtatttcaaattctctcagt
gttcctgaagaagccatcagtccaggagtcactaccagttggattgaagcaaacctccct
gatgattctaaagacagatggaagatgagggggaatgtggattatgtggtacttcttgac
tggtttagttctgcgagagatttacagcttggaacaactctacggagtctgaaagatgca
cttttcaagtgggaaagtaaaactctcctgcgcaatgagcctttggttttagagggaggc
tatgaaaactggcttctctgctatccccagtacacaacaaatgctaaagtcactccaccc
ccacgaggcaagaatgaagaggtgtctatttcattggattttacttacccctcactggaa
gaaccagttccttctaaacctactgcccaaatgccaccgcctcctatacaagtagacaaa
aatatagaattgaaaaagaatcaagatgagagaatggaaccacttaatttatcaactcca
gttgaaccaattgcttcttctaaatctgatgtttcgcctccagttcagccagtgcctatt
gtaaagagtgtaccacagattgatcgtactaaaaagccaacattaaaattacctgaagat
catagcgtaaaacctgaaagtacagactataagcaacagtcttctcaggatggaaaagtt
gttcctgatcgttccacaaagccaacattgactccaacagctgctatgttaacaggcgaa
gaaaaagctcgtattcatgcagaaactgctcttctaatggagaaaagcaaacaagaaaaa
gaacttcaggaaaggcaacaagaagaacagaaagagaaactgaggagggaagaacaagaa
gccagaaagaaatcagaagctgaagaaaatgaaatcacagagaaggaacaaaaaacaaaa
gaagaaatagaaaaaagggaaaatgaacagaccaagaaggaagataaagaaacctcagga
aagtggggcaaagaaataacaggaataaaaagacaaagtagaagtgaacatgaaactact
gatgccaagaaatctgtggaagacagagagaaaaggtgtccaaccccagaagtgccgaaa
aagtcaacaggagatgtgccccagacagaagattcaagttcaggcaaggctcaacgagaa
cctttgacaagagcacgaagtgaagaaatggggaggattgtaccaggattgccttcgggt
tgggccaagtttcttgacccagttactggaacctttcgttattatcattcgcccaccaac
actgttcatatgtatccaccggaaatggctccttcatctgcacctccttccacccctcca
gctcctaaagccaagccacagattcctgctgagcgggatagggaaccttccaaactgaag
cgctcctactcttccccagatataacccaggctgttcaagaggaagagaagaggaagcca
acagtaactccagcagttaatcgggaaaacaagccaatatgctaccctaaagctgaaatc
tcaaggctttctgcttctcaaattcggaacctcaatcctgtttttggaggatctggacca
gctctcactgggcttcgtaatttaggaaatacttgttacatgaactcaatattgcagtgc
ctatgcaatgctccacatttggctgattatttcaaccgaaactgttaccagaatgatatt
aataggtcaaatttgttgggacataaaggggaagttgcagaagaatttggtataatcatg
aaagccctgtggacaggacagtataggtatgtcagtccaaaagactttaaaatcaccatt
gggaagatcaatgaccagtttgcaggatacaaccagcaagattcacaagaactgcttctg
ttcctaatggatggtctccacgaagatctaaataaagctgataatcgaaagagacataaa
gaagagaataatgatcatcttgacgactttaaagcagcagaacatgcttggcagaagcac
aagcagctcaatgaatctattattgttgcgctttttcagggtcagttcaaatccacagtg
cagtgcctcacgtgtcacaaaaagtctaggacatttgaggcctttatgtatttgtccctg
ccactagcatccacaagtaaatgtacactacaggattgccttagattattttccaaagaa
gaaaaactcacggataacaacagattttactgcagtcattgcagagctcgacgggattct
ctaaaaaagatagaaatatggaagttgccacctgtgcttttagtgcatctgaaacgtttt
tcctatgatgggaggtggaagcaaaaattacagacatctgtggacttcccattagaaaat
cttgatttgtcacagtatgttattggtccaaagaacaatttgaagaaatacagcttgttt
tctgtttcaaatcactatggcggtctggatggaggccactacactgcctattgtaaaaat
gcagcaagacagcggtggtttaaatttgatgatcacgaagtttctgacatctctgtttct
tctgtgaagtcttcagcagcttatatcctcttttatacttcattgggaccacgagtaact
gatgtagccacataa

DBGET integrated database retrieval system